DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and VAMP5

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_006625.1 Gene:VAMP5 / 10791 HGNCID:12646 Length:116 Species:Homo sapiens


Alignment Length:112 Identity:43/112 - (38%)
Similarity:64/112 - (57%) Gaps:15/112 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQFEQQAGKLKRKQWWANMKM 111
            :|::.|.:.:||..|||.|..|||||..||:||.:|:|||...:|.|.:....|.:|:.|.|::.
Human     5 ELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRY 69

  Fly   112 MIILGVIAV----VLLIIVLVSVWPSSSDS-----------GSGGGN 143
            .|.:|::.|    ::||::||...|.||||           .||.||
Human    70 RICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 34/86 (40%)
VAMP5NP_006625.1 R-SNARE_VAMP5 3..70 CDD:277225 27/64 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..116 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146530
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.