DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and Vamp9

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001365349.1 Gene:Vamp9 / 102639650 MGIID:5595070 Length:214 Species:Mus musculus


Alignment Length:110 Identity:32/110 - (29%)
Similarity:56/110 - (50%) Gaps:7/110 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PPN--ANDNYNQFGDHQIR-NNNAAQKKLQQTQAKVDEVVGIMRVNVEKVLERD-QKLSELGERA 83
            |.|  |.|.......|.:. |...:...|...:::|.:|..:|..|::.||||: :.:|.|.|.|
Mouse   100 PSNALATDFQQILAQHMMEYNRTRSSSMLSVVKSRVSDVKSVMLRNMDAVLERETETVSVLTEEA 164

  Fly    84 DQLEQGASQFEQQAGKLKRKQWWANMKMMIILGVIAVVLLIIVLV 128
            |..:..|.:|| ...|:.::.||...|  |::..:|:.|.||:::
Mouse   165 DDPQATAEEFE-TTRKIPKRTWWKCFK--IVITTLAIPLSIIIIL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 26/86 (30%)
Vamp9NP_001365349.1 Longin 5..119 CDD:341428 5/18 (28%)
SNARE 125..191 CDD:419871 21/68 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836630
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.