DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12209 and CG42570

DIOPT Version :9

Sequence 1:NP_610565.2 Gene:CG12209 / 36077 FlyBaseID:FBgn0033498 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001163449.1 Gene:CG42570 / 8674011 FlyBaseID:FBgn0260776 Length:610 Species:Drosophila melanogaster


Alignment Length:294 Identity:129/294 - (43%)
Similarity:189/294 - (64%) Gaps:21/294 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RAYRRARRKFACVVYMVTIAWMVLAILQWLLVSLISDISMTFTNFYWISVIFFALAMVMVTVFIF 73
            |.||:|||||:...|.:.:.|::||:.|||:::.|.|...|||:.|:|.:..||||:::..:|||
  Fly     8 RYYRKARRKFSLKAYGLFVLWLILALAQWLVIAFIEDARTTFTSLYYICLATFALAILIFALFIF 72

  Fly    74 FEKVRFIIGLNWLITVLIVEFIIIGMFALVARTLWQDLIMWFIICVLFVFMFVLLGSIIP--HDL 136
            .||||||.|||::::::|||..||..|||||.:.|.|::.:|.:.::.:.:|:|:|..:|  .||
  Fly    73 IEKVRFIKGLNFIMSLIIVELQIISTFALVAISWWPDVLTFFAVALILMVLFLLIGVFLPARADL 137

  Fly   137 TLDVVILFVMAFIFLIITVFFVMMHIL--IDMPYSFVVFQIFISLIVLLFVMYHAQTINGGRFAE 199
            |||:.:||::||:|||:..|.::..:|  |.:||:::|.:|.|:..:|||||||||||||.||||
  Fly   138 TLDIAVLFILAFLFLIVACFILLFELLVRITIPYAYLVVEISITFTILLFVMYHAQTINGNRFAE 202

  Fly   200 MRLNDHLLASLILFHDFIIIFLLTFYAQIIYR-------------FASNAAKT--TGSPLEGSWV 249
            |||||..|.||||||||:|||.||||.||.||             :.:...:|  |...|:|...
  Fly   203 MRLNDFFLGSLILFHDFLIIFWLTFYWQIHYRPITPDTWLETSTPYYNGTIRTNDTYKSLDGDGT 267

  Fly   250 QTTP--INGDDVVEDNDEDSEDGPSAVGSENSPG 281
            ...|  ..|.|.....|.:::|.|.......:||
  Fly   268 TLAPWFTRGFDDGYGGDSNAKDYPEIPSGRGNPG 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12209NP_610565.2 sorted_by_XrtN 25..>188 CDD:275270 71/166 (43%)
CG42570NP_001163449.1 MFS <17..235 CDD:119392 109/217 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470050
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FBS5
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009992
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.