DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12209 and BXI1

DIOPT Version :9

Sequence 1:NP_610565.2 Gene:CG12209 / 36077 FlyBaseID:FBgn0033498 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_014094.1 Gene:BXI1 / 855411 SGDID:S000005249 Length:297 Species:Saccharomyces cerevisiae


Alignment Length:140 Identity:28/140 - (20%)
Similarity:60/140 - (42%) Gaps:36/140 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 MVTIAWMVLAILQWLLVS--LISDISMT-----FTN--------FYWISVIFFALAMVMVTVFIF 73
            :||:|:....:|..||::  ::..:|:|     |.|        :||::...:.:..:.:|..:|
Yeast   163 LVTLAYDKDTVLSALLITTIVVVGVSLTALSERFENVLNSATSIYYWLNWGLWIMIGMGLTALLF 227

  Fly    74 ---FEKVRFIIGLNWLITVLIVEFIIIGMFALVARTLWQDLIMWFIICVLFVFMFVLLGSIIPHD 135
               ....:|.:...||..:|...::.|.. .|:.|.::.|   ..:.|.:.::            
Yeast   228 GWNTHSSKFNLLYGWLGAILFTAYLFIDT-QLIFRKVYPD---EEVRCAMMLY------------ 276

  Fly   136 LTLDVVILFV 145
              ||:|.||:
Yeast   277 --LDIVNLFL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12209NP_610565.2 sorted_by_XrtN 25..>188 CDD:275270 28/139 (20%)
BXI1NP_014094.1 GAAP_like 21..294 CDD:198411 28/140 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.