Sequence 1: | NP_610565.2 | Gene: | CG12209 / 36077 | FlyBaseID: | FBgn0033498 | Length: | 285 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001184896.1 | Gene: | AT1G03070 / 839581 | AraportID: | AT1G03070 | Length: | 247 | Species: | Arabidopsis thaliana |
Alignment Length: | 210 | Identity: | 38/210 - (18%) |
---|---|---|---|
Similarity: | 79/210 - (37%) | Gaps: | 61/210 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 FFEKVRFIIGLNWLITVLIVEFII-IGMFALVARTLWQDLIMWFII--------CVLFVF----- 123
Fly 124 -MFVLLG--------------------SIIPHDLTLDVVIL-----------------FVMAFIF 150
Fly 151 --LIITVFFVMMHILIDM-PYSFVVFQIFISLIVLLFVMYHAQTINGGRFAEMRLNDHLLASLIL 212
Fly 213 FHDFIIIF--LLTFY 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12209 | NP_610565.2 | sorted_by_XrtN | 25..>188 | CDD:275270 | 29/169 (17%) |
AT1G03070 | NP_001184896.1 | GAAP_like | 5..247 | CDD:198411 | 38/210 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |