DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12209 and AT1G03070

DIOPT Version :9

Sequence 1:NP_610565.2 Gene:CG12209 / 36077 FlyBaseID:FBgn0033498 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001184896.1 Gene:AT1G03070 / 839581 AraportID:AT1G03070 Length:247 Species:Arabidopsis thaliana


Alignment Length:210 Identity:38/210 - (18%)
Similarity:79/210 - (37%) Gaps:61/210 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 FFEKVRFIIGLNWLITVLIVEFII-IGMFALVARTLWQDLIMWFII--------CVLFVF----- 123
            |..||..||....|.|:.:...:: :...|:...|....|.:|.::        |.|:.:     
plant    38 FIRKVYSIIAFQLLATIAVASTVVFVRPIAVFFATTSAGLALWIVLIITPLIVMCPLYYYHQKHP 102

  Fly   124 -MFVLLG--------------------SIIPHDLTLDVVIL-----------------FVMAFIF 150
             .::|||                    .|:...:...||:|                 |:..|:|
plant   103 VNYLLLGIFTVALAFAVGLTCAFTSGKVILEAAILTTVVVLSLTVYTFWAAKKGYDFNFLGPFLF 167

  Fly   151 --LIITVFFVMMHILIDM-PYSFVVFQIFISLIVLLFVMYHAQTINGGRFAEMRLNDHLLASLIL 212
              ||:.:.|.::.|...: ..|.:::....::|...:::|....:    ......::::.|::.|
plant   168 GALIVLMVFALIQIFFPLGRISVMIYGCLAAIIFCGYIVYDTDNL----IKRYSYDEYIWAAVSL 228

  Fly   213 FHDFIIIF--LLTFY 225
            :.|.|.:|  |||.:
plant   229 YLDIINLFLALLTIF 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12209NP_610565.2 sorted_by_XrtN 25..>188 CDD:275270 29/169 (17%)
AT1G03070NP_001184896.1 GAAP_like 5..247 CDD:198411 38/210 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.