DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12209 and BIL4

DIOPT Version :9

Sequence 1:NP_610565.2 Gene:CG12209 / 36077 FlyBaseID:FBgn0033498 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_191890.1 Gene:BIL4 / 825506 AraportID:AT3G63310 Length:239 Species:Arabidopsis thaliana


Alignment Length:230 Identity:45/230 - (19%)
Similarity:87/230 - (37%) Gaps:50/230 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RRKFACVVYMVTIAWMVLAILQWLLVSLISDISMTFT----NFYWISVIFFALAMVMVTVFIFFE 75
            |..|...||.:....:::.|.....|..:..||:.||    .|....::.....:||..::.:.:
plant    26 RWSFIRKVYSIISIQLLVTIAVAATVVKVHSISVFFTTTTAGFALYILLILTPLIVMCPLYYYHQ 90

  Fly    76 K--------------VRFIIGLNWLIT--VLIVEFIIIGMFALVARTLWQDLIMWFIICVLFVFM 124
            |              :.|.:||....|  .:|:|.:|:....:::.|             |:.|.
plant    91 KHPVNYLLLGIFTVALAFAVGLTCAFTSGKVILESVILTAVVVISLT-------------LYTFW 142

  Fly   125 FVLLGSIIPHDLTLDVVILFVMAFIFLIITVFFVMMHILIDMP---YSFVVFQIFISLIVLLFVM 186
            ....|    ||..      |:..|:|..:.|..|...|.|..|   .|.:::....|:|...:::
plant   143 AAKRG----HDFN------FLGPFLFGAVIVLMVFSFIQILFPLGKISVMIYGCLASIIFCGYIV 197

  Fly   187 YHAQTINGGRFAEMRLNDHLLASLILFHDFIIIFL 221
            |....:    ......::::.|::.|:.|.|.:||
plant   198 YDTDNL----IKRHSYDEYIWAAVSLYLDVINLFL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12209NP_610565.2 sorted_by_XrtN 25..>188 CDD:275270 34/185 (18%)
BIL4NP_191890.1 BI-1-like 22..225 CDD:320991 42/225 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.