DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12209 and CG34315

DIOPT Version :9

Sequence 1:NP_610565.2 Gene:CG12209 / 36077 FlyBaseID:FBgn0033498 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001097298.2 Gene:CG34315 / 5740282 FlyBaseID:FBgn0085344 Length:266 Species:Drosophila melanogaster


Alignment Length:263 Identity:100/263 - (38%)
Similarity:171/263 - (65%) Gaps:13/263 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDRRQRMRAYRRARRKFACVVYMVTIAWMVLAILQWLLVSLISDISMTFTNFYWISVIFFALAM 65
            |.|..::...|::.|||||.:.|::|..:::||:|||.....::.:...||:::|:|.:||.:.:
  Fly     1 MADIPEKSSYYKKERRKFALITYLLTAIFLILALLQWATFRFVNFLREFFTSYHWLSCLFFGIGL 65

  Fly    66 VMVTVFIFFEKVRFIIGLNWLITVLIVEFIIIGMFALVARTLWQDLIMWFIICVLFVFMFVLLGS 130
            :::.:|||||.:||...:|||...||.|.|::|:..||||......:..|:|..:.:.:|::.||
  Fly    66 ILLVLFIFFEVLRFNKMVNWLFAFLIFECIVLGIAPLVARHYKYQFLFSFLIWTVALALFIVCGS 130

  Fly   131 IIPHDLTLDVVILFVMAFIFLIITVFFVMMHILIDMPYSFVVFQIFISLIVLLFVMYHAQTINGG 195
            .:|.|||||||:|||:|.:.:|..::|||::|:.::.|||::.:.||.:.:|:|||||||.||||
  Fly   131 FLPLDLTLDVVVLFVLAVVSIIGAIYFVMLYIVANVAYSFIIARCFIVISILMFVMYHAQIINGG 195

  Fly   196 RFAEMRLNDHLLASLILFHDFIIIFLLTFYAQIIYRFASNA-----------AKTTGSPLEGSWV 249
            ||||||..|:.||::|||.||::::|.:|  |:..:::...           .:||.:.....|.
  Fly   196 RFAEMRTKDYFLAAIILFLDFLLLYLFSF--QVAPKWSDRCDGERSKNLVLFTETTTNSYPPKWW 258

  Fly   250 QTT 252
            :|:
  Fly   259 RTS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12209NP_610565.2 sorted_by_XrtN 25..>188 CDD:275270 62/162 (38%)
CG34315NP_001097298.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470054
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FBS5
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009992
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.