DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12209 and CG32391

DIOPT Version :9

Sequence 1:NP_610565.2 Gene:CG12209 / 36077 FlyBaseID:FBgn0033498 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001163365.2 Gene:CG32391 / 318007 FlyBaseID:FBgn0052391 Length:244 Species:Drosophila melanogaster


Alignment Length:213 Identity:58/213 - (27%)
Similarity:124/213 - (58%) Gaps:2/213 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RRKFACVVYMVTIAWMVLAILQWLLV-SLISDISMTFTNFYWISVIF-FALAMVMVTVFIFFEKV 77
            ||::...|.:....::|:..:.|:|| :|:.:..:...|.:..:::. |...:.::.:|.....:
  Fly    20 RRRYIIKVILELCVFIVIGFVHWILVLTLLHEWFLVLVNEHSSALLLAFVFGIFLLFLFALSMPL 84

  Fly    78 RFIIGLNWLITVLIVEFIIIGMFALVARTLWQDLIMWFIICVLFVFMFVLLGSIIPHDLTLDVVI 142
            |.:..:|||||.:|||.:::.:..|:..:....::..|:|..|...:..|:.:::.:|||...:.
  Fly    85 RKMSCVNWLITFIIVECVVVSLSVLIISSGVLYMLAGFLIVSLAFVLCTLIAALMAYDLTGTGLY 149

  Fly   143 LFVMAFIFLIITVFFVMMHILIDMPYSFVVFQIFISLIVLLFVMYHAQTINGGRFAEMRLNDHLL 207
            |:.:|.....::::.:::::::|:.:.|.:|...|..:|::|:|||.|.|.|||.|..:|.|...
  Fly   150 LYALATGTYSLSIYSLVLYVVLDVIWGFYLFAFCIGCVVMMFLMYHVQCIMGGRRASTKLFDDKF 214

  Fly   208 ASLILFHDFIIIFLLTFY 225
            |:|:|||:||.:|:||.|
  Fly   215 AALLLFHEFIGLFVLTLY 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12209NP_610565.2 sorted_by_XrtN 25..>188 CDD:275270 34/164 (21%)
CG32391NP_001163365.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009992
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.