| Sequence 1: | NP_610565.2 | Gene: | CG12209 / 36077 | FlyBaseID: | FBgn0033498 | Length: | 285 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_588431.1 | Gene: | bxi1 / 2539556 | PomBaseID: | SPCC576.04 | Length: | 266 | Species: | Schizosaccharomyces pombe |
| Alignment Length: | 203 | Identity: | 46/203 - (22%) |
|---|---|---|---|
| Similarity: | 79/203 - (38%) | Gaps: | 63/203 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 73 FFEKVRFIIGLNWLITVLIVEFIIIGMFAL-VARTLWQDLIMWFIICVLFVFMFVLLGSII-PHD 135
Fly 136 ----------------LTLDVVI-----------LFVMAFIFLIITVF---------------FV 158
Fly 159 MMHILIDMPYSF----------VVFQIFISLIVLLFVMYHAQTINGGRFAEMRLNDHLLASLILF 213
Fly 214 HDFIIIFL 221 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12209 | NP_610565.2 | sorted_by_XrtN | 25..>188 | CDD:275270 | 37/168 (22%) |
| bxi1 | NP_588431.1 | GAAP_like | 29..261 | CDD:198411 | 46/203 (23%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||