DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hdc and Sepsecs

DIOPT Version :9

Sequence 1:NP_001260855.1 Gene:Hdc / 36076 FlyBaseID:FBgn0005619 Length:847 Species:Drosophila melanogaster
Sequence 2:NP_001121759.1 Gene:Sepsecs / 679383 RGDID:1589491 Length:504 Species:Rattus norvegicus


Alignment Length:175 Identity:38/175 - (21%)
Similarity:64/175 - (36%) Gaps:40/175 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 MRGKLLR---EAIEDDIKQGLVPFWVCATLGTTGSCSF----DNLEEIGIVCAEHHLWLHVDAAY 275
            :.|..||   :|:|..| |.|.|..:.. |.:|.:|..    |.|||:.::||.:.:...|:.||
  Rat   193 LEGDELRTDLKAVEAKI-QELGPEHILC-LHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAY 255

  Fly   276 AGSAFICPEFRTWLRGIERADSIAFNPSKWLMVHFDATALWVRDSTAVHRTFN------VEPLYL 334
            ...:..|.........:.|.|....:..|..||....         |:...||      :..:|.
  Rat   256 GLQSSKCMHLIQQGARVGRIDVFVQSLDKNFMVPVGG---------AIIAGFNDSFIQEISKMYP 311

  Fly   335 QHENSGVAVDFMHWQIPLSRRFRALKVWFVLRSYGIKGLQRHIRE 379
            ...::..::|                |...|.|.|..|.::.::|
  Rat   312 GRASASPSLD----------------VLITLLSLGCNGYKKLLKE 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HdcNP_001260855.1 Pyridoxal_deC 35..413 CDD:278699 38/175 (22%)
SepsecsNP_001121759.1 selenium_SpcS 13..458 CDD:211833 38/175 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.