DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hdc and b

DIOPT Version :9

Sequence 1:NP_001260855.1 Gene:Hdc / 36076 FlyBaseID:FBgn0005619 Length:847 Species:Drosophila melanogaster
Sequence 2:NP_001246025.1 Gene:b / 34791 FlyBaseID:FBgn0000153 Length:575 Species:Drosophila melanogaster


Alignment Length:387 Identity:109/387 - (28%)
Similarity:177/387 - (45%) Gaps:32/387 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RERRVFPDVSPGYMRQLLPESAPIEGEPWPKIFSDVERIVMPGITHWQSPHMHAYFPALNSMPS- 88
            |..:|.....|..:|||.......:||...|:     |.::.....:.....|.||  :|.:.| 
  Fly   118 RSSKVVEWHEPAELRQLFDFQLREQGESQDKL-----RELLRETIRFSVKTGHPYF--INQLYSG 175

  Fly    89 -----LLGDMLADAINCLGFTWASSPACTELEIIVMNWLGKMIGLPDAFLHLSSQSQGGGVLQTT 148
                 |:|..|.||:|...:|:..:|..|.:|..|:..:.:::|.|:.       .||.|:....
  Fly   176 VDPYALVGQWLTDALNPSVYTYEVAPLFTLMEEQVLAEMRRIVGFPNG-------GQGDGIFCPG 233

  Fly   149 ASEATLVCLLAGRTRAIQRFHERHPGYQDAEINAR-LVAYCSDQAHSSVEKAAL---IGLVRMRY 209
            .|.|.      |...:..|:.......::...||: |:.:.|:.||.||||.|:   .|...:|.
  Fly   234 GSIAN------GYAISCARYRHSPESKKNGLFNAKPLIIFTSEDAHYSVEKLAMFMGFGSDHVRK 292

  Fly   210 IEADDDLAMRGKLLREAIEDDIKQGLVPFWVCATLGTTGSCSFDNLEEIGIVCAEHHLWLHVDAA 274
            |..::...||...|.:.::..::.|..|..|.||.|||...:||:|..|..||.::::|:|||||
  Fly   293 IATNEVGKMRLSDLEKQVKLCLENGWQPLMVSATAGTTVLGAFDDLAGISEVCKKYNMWMHVDAA 357

  Fly   275 YAGSAFICPEFRTWLRGIERADSIAFNPSKWLMVHFDATALWVRDSTAVHRTFNVEPLYLQHENS 339
            :.|.|.:..::|..|.|||||||:.:||.|.|......:....|....:.:..:....||..::.
  Fly   358 WGGGALMSKKYRHLLNGIERADSVTWNPHKLLAASQQCSTFLTRHQQVLAQCHSTNATYLFQKDK 422

  Fly   340 --GVAVDFMHWQIPLSRRFRALKVWFVLRSYGIKGLQRHIREGVRLAQKFEALVLADHRFEL 399
              ..:.|.....|...||....|.||:.::.|.:||:.|:.:..|:|:.|.|.|.....|||
  Fly   423 FYDTSFDTGDKHIQCGRRADVFKFWFMWKAKGTQGLEAHVEKVFRMAEFFTAKVRERPGFEL 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HdcNP_001260855.1 Pyridoxal_deC 35..413 CDD:278699 107/377 (28%)
bNP_001246025.1 AAT_I 128..499 CDD:302748 107/377 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445357
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.