DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hdc and DDC

DIOPT Version :9

Sequence 1:NP_001260855.1 Gene:Hdc / 36076 FlyBaseID:FBgn0005619 Length:847 Species:Drosophila melanogaster
Sequence 2:NP_000781.2 Gene:DDC / 1644 HGNCID:2719 Length:480 Species:Homo sapiens


Alignment Length:476 Identity:253/476 - (53%)
Similarity:345/476 - (72%) Gaps:3/476 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFKEYRQRGKEMVDYIADYLENIRERRVFPDVSPGYMRQLLPESAPIEGEPWPKIFSDVERIVM 65
            |:..|:|:||||||||:|:|:|.|..|:|:|||.|||:|.|:|.:||.|.:.:..|.:|||:|:|
Human     1 MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIM 65

  Fly    66 PGITHWQSPHMHAYFPALNSMPSLLGDMLADAINCLGFTWASSPACTELEIIVMNWLGKMIGLPD 130
            ||:|||.||:..||||..:|.|::|.|||..||.|:||:||:||||||||.::|:|||||:.||.
Human    66 PGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPK 130

  Fly   131 AFLHLSSQSQGGGVLQTTASEATLVCLLAGRTRAIQRFHERHPGYQDAEINARLVAYCSDQAHSS 195
            |||: ....:||||:|.:|||||||.|||.||:.|.|.....|....|.|..:||||.|||||||
Human   131 AFLN-EKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSS 194

  Fly   196 VEKAALIGLVRMRYIEADDDLAMRGKLLREAIEDDIKQGLVPFWVCATLGTTGSCSFDNLEEIGI 260
            ||:|.|||.|:::.|.:|.:.|||...|:||:|.|...||:||::.||||||..||||||.|:|.
Human   195 VERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGP 259

  Fly   261 VCAEHHLWLHVDAAYAGSAFICPEFRTWLRGIERADSIAFNPSKWLMVHFDATALWVRDSTAVHR 325
            :|.:..:|||||||||||||||||||..|.|:|.|||..|||.|||:|:||.:|:||:..|.:..
Human   260 ICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTG 324

  Fly   326 TFNVEPLYLQ--HENSGVAVDFMHWQIPLSRRFRALKVWFVLRSYGIKGLQRHIREGVRLAQKFE 388
            .|.::|.||:  |::||:..|:.||||||.||||:||:|||.|.||:||||.:||:.|:|:.:||
Human   325 AFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFE 389

  Fly   389 ALVLADHRFELPAKRHLGLVVFRIRGDNEITEKLLKRLNHRGNLHCIPSSLKGQYVIRFTITSTH 453
            :||..|.|||:..:..||||.||::|.|::.|.||:|:|....:|.:|..|:.::|:||.|.|..
Human   390 SLVRQDPRFEICVEVILGLVCFRLKGSNKVNEALLQRINSAKKIHLVPCHLRDKFVLRFAICSRT 454

  Fly   454 TTLDDIVKDWMEIRQVASTVL 474
            .....:.:.|..|:::|:.||
Human   455 VESAHVQRAWEHIKELAADVL 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HdcNP_001260855.1 Pyridoxal_deC 35..413 CDD:278699 213/379 (56%)
DDCNP_000781.2 Pyridoxal_deC 35..414 CDD:365998 213/379 (56%)
2 X approximate tandem repeats 58..178 68/120 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57772
OrthoDB 1 1.010 - - D223497at33208
OrthoFinder 1 1.000 - - FOG0000865
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100572
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X696
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.