DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hdc and gad1a

DIOPT Version :9

Sequence 1:NP_001260855.1 Gene:Hdc / 36076 FlyBaseID:FBgn0005619 Length:847 Species:Drosophila melanogaster
Sequence 2:XP_002663350.1 Gene:gad1a / 100329827 ZFINID:ZDB-GENE-070912-472 Length:591 Species:Danio rerio


Alignment Length:505 Identity:114/505 - (22%)
Similarity:213/505 - (42%) Gaps:100/505 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EMVDYIADYLENI--RERRVFPDVSP--------GYMRQLLPESAPIEGEPWPKIFSDVERIVMP 66
            |:|:.:.:|:...  |..:|.....|        |:..:|..:...:|     :|..|....:..
Zfish   116 EVVEILTNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELCDQPESLE-----QILVDCRDTLKY 175

  Fly    67 GITHWQSPHMHAYFPALNS---MPSLLGDMLADAINCLGFTWASSPACTELEIIVMNWLGKMIGL 128
            |:   ::.|.. :|..|:|   :..|.|:.|....|...||:..:|....:|.:.:..:.:::|.
Zfish   176 GV---RTGHPR-FFNQLSSGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIVGW 236

  Fly   129 PDAFLHLSSQSQGGGVLQTTASEATLVCLLAGRTRAIQRFHERHPGYQDAEINA-----RLVAYC 188
            |:        .:|.|:.....:.:.:..::..          |:..|.:.:|..     |||.:.
Zfish   237 PN--------GEGDGIFSPGGAISNMYSVMVA----------RYKHYPEIKIKGMAAAPRLVLFT 283

  Fly   189 SDQAHSSVEKAALI---GLVRMRYIEADDDLAMRGKLLREAIED---DIKQ-GLVPFWVCATLGT 246
            |:.:|.|::||:.:   |...:..:..|:    ||:::...:|.   |.|| |.||.:|.||.|:
Zfish   284 SEHSHYSIKKASAVLGFGTENLILLRTDE----RGRVIPADLEAKVIDAKQKGFVPMFVNATAGS 344

  Fly   247 TGSCSFDNLEEIGIVCAEHHLWLHVDAAYAGSAFICPEFRTWLRGIERADSIAFNPSKWLMVHFD 311
            |...:||.:.||..:|.::::|||||.|:.|...:..:.:..|.|||||:|:.:||.|.:.|...
Zfish   345 TVYGAFDPINEIADICEKYNMWLHVDGAWGGGLLMSRKHKHKLSGIERANSVTWNPHKMMGVPLQ 409

  Fly   312 ATALWVRDSTAVHRTFNVEPLYL-----QHENSGVAVDFMHWQIPLSRRFRALKVWFVLRSYGIK 371
            .:|:.||:...:....::...||     |::   |..|.....|...|.....|.|.:.:|.|..
Zfish   410 CSAILVREKGLLQGCNSMCAGYLFQPDKQYD---VTYDTGDKAIQCGRHVDIFKFWLMWKSKGTT 471

  Fly   372 GLQRHIREGVRLAQKFEALVLADHRFELPAK---RHLGLVVF------RIRGDNEITEKLLKRLN 427
            |.::||...:.|::.....:.....:|:..:   :|..:..:      |:..|.|  ||     .
Zfish   472 GFEKHIDRCLELSEYLYHKIKNREGYEMVFQGEPQHTNVCFWYIPPSLRLLPDGE--EK-----R 529

  Fly   428 HRGNLHCIPSSLK----------------GQYV--IRFTITSTHTTLDDI 459
            ||  ||.:...:|                |:.|  .|..:::...|..||
Zfish   530 HR--LHKVAPKIKALMMECGTTMVGYQPQGEKVNFFRMVVSNPAVTRSDI 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HdcNP_001260855.1 Pyridoxal_deC 35..413 CDD:278699 94/414 (23%)
gad1aXP_002663350.1 Pyridoxal_deC 141..515 CDD:278699 93/407 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.