DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hdc and gad3

DIOPT Version :9

Sequence 1:NP_001260855.1 Gene:Hdc / 36076 FlyBaseID:FBgn0005619 Length:847 Species:Drosophila melanogaster
Sequence 2:NP_001083039.2 Gene:gad3 / 100038790 ZFINID:ZDB-GENE-070424-80 Length:546 Species:Danio rerio


Alignment Length:456 Identity:114/456 - (25%)
Similarity:187/456 - (41%) Gaps:95/456 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFKEYRQRGKEMVDYIADYLENIRE------RRVFPDVSPGYMRQLLPESAPIEGEPWPKIF-S 58
            |||.:..:|..:........|||..:      .||..|.|..:.:.|||..   :||...|.| .
Zfish     9 MDFTQADRRHLDKSKQDTSSLENTDDGLKYDSGRVTHDFSCIHSKDLLPAE---DGEEATKHFLQ 70

  Fly    59 DVERIVMPGIT------------HWQSPHM----------------------------------- 76
            ::..|::..|:            |:  ||.                                   
Zfish    71 ELVNILLAYISKSLKRSTKVLDFHY--PHQLNEGLEGFSLELPDQPDNLEQLLVDCRDTLKYGVK 133

  Fly    77 --H-AYFPALNS---MPSLLGDMLADAINCLGFTWASSPACTELEIIVMNWLGKMIGLPDAFLHL 135
              | .:|..|::   :..|.|:.|....|...||:..||....:|.:|:..:..:||.|      
Zfish   134 TGHPRFFNQLSTGLDIVGLAGEWLTSTANTNMFTYEISPVFILMEEVVLRKMHTIIGWP------ 192

  Fly   136 SSQSQGGGVLQTTASEATLVCLLAGRTRAIQRFHERHPGYQDAEINA--RLVAYCSDQAHSSVEK 198
              :..|.|:.....|.:.|..:|      :.||| ..|..:...:.|  ||..:.|..:|.|::|
Zfish   193 --EEDGDGIFCPGGSMSNLYSVL------LARFH-LFPAVKTHGMCAIPRLAMFTSAHSHYSIKK 248

  Fly   199 AAL---IGLVRMRYIEADDDLAMRGKL----LREAIEDDIKQGLVPFWVCATLGTTGSCSFDNLE 256
            :|.   ||...:..:..|:    |||:    |..:||:...:|||||:|.||.|||...:||.|.
Zfish   249 SAAVLGIGTENVIVVRCDE----RGKMISSELNSSIEEAKSKGLVPFYVNATAGTTVYGAFDPLH 309

  Fly   257 EIGIVCAEHHLWLHVDAAYAGSAFICPEFRTWLRGIERADSIAFNPSKWLMVHFDATALWVRDST 321
            :|..:|..|.||:|||||:.|...:..:.|..|.|||||.|:.:||.|.:.|....:.:.|:...
Zfish   310 KIADICEHHGLWMHVDAAWGGGLLLSNKHRVKLHGIERAHSVTWNPHKMMGVPLQCSTILVKRKG 374

  Fly   322 AVHRTFNV--EPLYLQHENSGVAVDFMHWQIPLSRRFRALKVWFVLRSYGIKGLQRHIREGVRLA 384
            .:.:...:  |.|:...::..|:.|.....|...|.....|:|.:.::.|.:|.:..:...:..|
Zfish   375 LLQQCNQLCAEYLFQPDKHYEVSYDTGDKSIQCGRHVDIFKLWLMWKAKGSEGFESQVNHCLENA 439

  Fly   385 Q 385
            :
Zfish   440 E 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HdcNP_001260855.1 Pyridoxal_deC 35..413 CDD:278699 103/416 (25%)
gad3NP_001083039.2 Pyridoxal_deC 96..469 CDD:278699 93/364 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.