DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr3 and kni

DIOPT Version :9

Sequence 1:NP_001334718.1 Gene:Hr3 / 36073 FlyBaseID:FBgn0000448 Length:871 Species:Drosophila melanogaster
Sequence 2:NP_001287130.1 Gene:kni / 40287 FlyBaseID:FBgn0001320 Length:434 Species:Drosophila melanogaster


Alignment Length:286 Identity:74/286 - (25%)
Similarity:110/286 - (38%) Gaps:85/286 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 CKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVNY-QCPRNKQCVVDRVNRNRCQYCRLQKCLKL 500
            |||||:.::|.|:|..||||||.||.||.:::... :|....:|::|:.||..|:.|||:||..:
  Fly    10 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNISTISECKNEGKCIIDKKNRTTCKACRLRKCYNV 74

  Fly   501 GMSRDAVKFGRMSKKQREKVEDEVRFHRAQMRAQSDAAP-------------DSSVYDTQTPSSS 552
            |||:...::||.|  ...|:...::.|.....|...|.|             .|.|....||...
  Fly    75 GMSKGGSRYGRRS--NWFKIHCLLQEHEQAAAAAGKAPPLAGGVSVGGAPSASSPVGSPHTPGFG 137

  Fly   553 D---QLHHNNYNSG-------------GYSN---------------NEVGYGSPY---------G 577
            |   .|||::....             ||.:               ..|.:.||:         |
  Fly   138 DMAAHLHHHHQQQQQQQVPRHPHMPLLGYPSYLSDPSAALPFFSMMGGVPHQSPFQLPPHLLFPG 202

  Fly   578 YSASVTP-----------QQTMQYDISADYVDS-TTYEPRS--TIIDPEFISHADGDINDVLIKT 628
            |.||...           |:..::..|.|.|:| ..:.|.|  .::.|  .|.|.....||.:: 
  Fly   203 YHASAAAAAASAADAAYRQEMYKHRQSVDSVESQNRFSPASQPPVVQP--TSSARQSPIDVCLE- 264

  Fly   629 LAEAHANTNTKLEAVHDMFRKQPDVS 654
                        |.||.:...|...|
  Fly   265 ------------EDVHSVHSHQSSAS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr3NP_001334718.1 None
kniNP_001287130.1 NR_DBD_like 8..92 CDD:295381 35/83 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5442
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.