DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr3 and knrl

DIOPT Version :9

Sequence 1:NP_001334718.1 Gene:Hr3 / 36073 FlyBaseID:FBgn0000448 Length:871 Species:Drosophila melanogaster
Sequence 2:NP_001303368.1 Gene:knrl / 40285 FlyBaseID:FBgn0001323 Length:647 Species:Drosophila melanogaster


Alignment Length:144 Identity:49/144 - (34%)
Similarity:76/144 - (52%) Gaps:23/144 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 CKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVNY-QCPRNKQCVVDRVNRNRCQYCRLQKCLKL 500
            |||||:.::|.|:|..||||||.||.||.:::.:. .|..|.:|::::.||..|:.|||:|||.:
  Fly    14 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLSSISDCKNNGECIINKKNRTACKACRLKKCLMV 78

  Fly   501 GMSRDAVKFGRMSKKQREKVEDEVRFHRAQMRAQSDAAPDSSVYDTQTPSSSDQLHHNNYNSGGY 565
            |||:...::||.|        :..:.|......|..|.            ::...|||:..:||.
  Fly    79 GMSKSGSRYGRRS--------NWFKIHCLLQEQQQQAV------------AAMAAHHNSQQAGGG 123

  Fly   566 SN--NEVGYGSPYG 577
            |:  :..|.|.|.|
  Fly   124 SSGGSGGGQGMPNG 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr3NP_001334718.1 None
knrlNP_001303368.1 NR_DBD_like 12..96 CDD:295381 36/89 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.