DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mlt and PFI

DIOPT Version :9

Sequence 1:NP_001260853.1 Gene:mlt / 36072 FlyBaseID:FBgn0265512 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_565017.1 Gene:PFI / 843485 AraportID:AT1G71440 Length:531 Species:Arabidopsis thaliana


Alignment Length:493 Identity:133/493 - (26%)
Similarity:214/493 - (43%) Gaps:88/493 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLLEALERKYFAECEFENAHQPELHKRSDLPNDFTVTKCGGRM---------EFSIFIPRLSPLT 58
            :||:|||.:|            ......|..::..|...|.|.         :....:.|...||
plant    85 TLLQALELRY------------RTISTKDEEDEMYVLSAGNRRVSIQLLGGDKIQDKLSRFEELT 137

  Fly    59 SVPALLVLNDCDIDSAGDFDSIREKCQRVRELDLAQNKLSDWSEVFSILEHMPRIEFLNLSKNQL 123
            |. :|..|....:..:.|..||   ...::.|||..|.:|||.|:.::.|.:|.:..||||.|.|
plant   138 SA-SLSYLGVSSLGVSSDLGSI---LPNLKLLDLTGNLISDWEEIGALCEQLPALTTLNLSCNSL 198

  Fly   124 ASPIGTLPTAPTINLKSLVLNGTYLDWACVDTLLKNLPVLQELHLSLNNYRQVLIDAEEAEQRLQ 188
            :|.|.:||...  |::.||||.:.|.|..|:.|.::||.::||||..|....:...:...:|   
plant   199 SSDIKSLPQLK--NIRVLVLNNSGLSWTQVEILRRSLPGIEELHLMGNMISTITSTSSSDDQ--- 258

  Fly   189 ETETPEETERRITKAHPALKTLHFTGNPVEHWQEICRLGRLFPNLEALVLADCPI----KSLQAE 249
                          |..:|:.|:...|.:..|.|:.:|.:| |.||.|.|....:    :|:...
plant   259 --------------AFNSLRLLNLDDNCISDWSEVLKLSQL-PCLEQLYLNKNKLSRIFQSVNGT 308

  Fly   250 ESSET-HRYFPSLRLLNLSSAQLDSWAAIDELAKFSELRNLRVKHWPLWESLECTEHERRQLLIA 313
            ||||. ...||||..|.|.:..:...|::|.|..|.:|.::|:...|:.:.:.  ....|.:|:|
plant   309 ESSEKGSDPFPSLSCLLLGANNIGDLASVDALNGFPQLVDIRLSENPISDPVR--GGVPRFVLVA 371

  Fly   314 RLPNVEMLNGGGKISSDERVDSERAFVRYYMDKPEEE-------RPARYQELLQIHGKLDP---- 367
            ||..|::|| |.::.:.|:.|||..:||..|.|..::       .| |:.||.::||..|.    
plant   372 RLTKVQVLN-GSEVRAREKKDSEIRYVRMVMSKLNDKSGEIELLHP-RFYELKKLHGIEDERASA 434

  Fly   368 -----------LVNVSLK---PDKRVKVLFTYNDVSESRFVDIYLTVNDLKVKLEKLVGLAPNKM 418
                       |::::||   |....|...|       :.:...:||..||:..|....|...|.
plant   435 ENSGPKNIASGLISITLKCVGPSMGEKPHLT-------KKLPGSITVGKLKILSENFFKLKSIKP 492

  Fly   419 RLYYLDQDYKEFGPEEMRYPNKQLYSYNIQSGDEIIID 456
            || :|.::...| |..:......|....|..|..:::|
plant   493 RL-FLQEEGSPF-PTALDDETATLLDVGICDGSTLLVD 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mltNP_001260853.1 LRR <46..>177 CDD:227223 45/130 (35%)
LRR_RI 57..>276 CDD:238064 69/223 (31%)
leucine-rich repeat 87..112 CDD:275380 9/24 (38%)
leucine-rich repeat 113..137 CDD:275380 10/23 (43%)
leucine-rich repeat 138..162 CDD:275380 9/23 (39%)
leucine-rich repeat 207..232 CDD:275380 7/24 (29%)
leucine-rich repeat 233..260 CDD:275380 10/31 (32%)
leucine-rich repeat 261..285 CDD:275380 7/23 (30%)
UBQ 379..456 CDD:294102 17/76 (22%)
PFINP_565017.1 CAP_GLY 12..81 CDD:214997
leucine-rich repeat 136..161 CDD:275380 8/28 (29%)
PPP1R42 157..384 CDD:411060 79/252 (31%)
leucine-rich repeat 162..187 CDD:275380 9/24 (38%)
leucine-rich repeat 188..210 CDD:275380 10/23 (43%)
leucine-rich repeat 211..225 CDD:275380 6/13 (46%)
leucine-rich repeat 236..262 CDD:275380 7/42 (17%)
leucine-rich repeat 263..287 CDD:275380 7/24 (29%)
leucine-rich repeat 288..320 CDD:275380 10/31 (32%)
leucine-rich repeat 321..345 CDD:275380 7/23 (30%)
Ubl_TBCE 446..528 CDD:340564 21/90 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15140
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.