DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mlt and tbce

DIOPT Version :9

Sequence 1:NP_001260853.1 Gene:mlt / 36072 FlyBaseID:FBgn0265512 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001035078.2 Gene:tbce / 664760 ZFINID:ZDB-GENE-051030-120 Length:521 Species:Danio rerio


Alignment Length:489 Identity:118/489 - (24%)
Similarity:211/489 - (43%) Gaps:91/489 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALERKYFAECEFENAHQPELHKRSDLPNDFTVTKCGGRMEFSIFIPRLSPLTSVPAL--LVLNDC 69
            ||:::|..|.|...|.:.::..:       ||...|        ...:....||..|  :.|..|
Zfish    81 ALKQRYEVEIEEVTAEEMKISSK-------TVVMVG--------FENVKKKQSVKNLTEVGLRRC 130

  Fly    70 DIDSAGDFDSIREKCQRVRELDLAQNKLSDWSEVFSILEHMPRIEFLNLSKNQLASPIGTLPTAP 134
            ::.:.|..:.||.....|:.|||:.|.||.|..:.:|.|.:..::.|:||.|:|:  |.:.|::.
Zfish   131 EVSAPGPENEIRNTTPFVQSLDLSGNLLSSWEVLAAITEQLDSLQELHLSHNRLS--ISSAPSSL 193

  Fly   135 T---INLKSLVLNGTYLDWACVDTLLKNLPV---LQELHLSLNNYRQVLIDAEEAEQRLQETETP 193
            :   .:|:.|.:|...|.|..|   |...|:   ::||:|:.||..::|    ..|..||     
Zfish   194 SSAFSHLRVLSINSCALTWTQV---LHCAPMWQQVEELYLADNNITELL----RPEHVLQ----- 246

  Fly   194 EETERRITKAHPALKTLHFTGNPVEHWQEICRLGRLFPNLEALVLADCPIKSLQAEE--SSETHR 256
                        ||..|..:.|.:.. :.:..:..| |.||.|.|:...:..::..:  :.:...
Zfish   247 ------------ALTVLDLSNNQIAQ-ETVLEISHL-PRLERLNLSSTSLSEIKFSDVPAGKKTT 297

  Fly   257 YFPSLRLLNLSSAQLDSWAAIDELAKFSELRNLRVKHWPLW---ESLECTEHERRQLLIARLPNV 318
            .||:|:.|.|....:..|..::||.|...|..|..:..||.   ::||..    ||::||||..:
Zfish   298 LFPALKELLLDDNNISEWRVVNELEKLPSLVYLSCRRNPLLHKEKNLETA----RQIMIARLGQL 358

  Fly   319 EMLNGGGKISSDERVDSERAFVRYYMD---------KPEEERP--------ARYQELLQIHGKLD 366
            |:|: ..:|.||||..:|..:.:.:..         :.|:..|        .||..|:|.:|..|
Zfish   359 ELLD-MRQILSDERRGAELDYCKMFGSAWLRAGGHREAEKNNPNTDFMTEHPRYLTLIQKYGAPD 422

  Fly   367 PLVNVSLKP----DKRVKVLFTYNDVSESRFVDIYL----TVNDLKVKLEKLVGLAPNKMRLYYL 423
            .......||    ::.:.:.|...:..|.:.::..|    .|..:|..|.:|:.|...:::|.| 
Zfish   423 EGELREQKPFALKNQLLTITFLCPEDLERKPIEKKLPGSMIVQKVKGLLHRLLKLPGVELKLTY- 486

  Fly   424 DQDYKEFGPEEMRYPN--KQLYSYNIQSGDEIII 455
              ...:....|:...|  |.|..|:::.||:|::
Zfish   487 --TCAKMADREIEIDNDLKPLQFYSVEDGDKILV 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mltNP_001260853.1 LRR <46..>177 CDD:227223 38/138 (28%)
LRR_RI 57..>276 CDD:238064 58/228 (25%)
leucine-rich repeat 87..112 CDD:275380 10/24 (42%)
leucine-rich repeat 113..137 CDD:275380 7/26 (27%)
leucine-rich repeat 138..162 CDD:275380 7/23 (30%)
leucine-rich repeat 207..232 CDD:275380 4/24 (17%)
leucine-rich repeat 233..260 CDD:275380 5/28 (18%)
leucine-rich repeat 261..285 CDD:275380 7/23 (30%)
UBQ 379..456 CDD:294102 18/83 (22%)
tbceNP_001035078.2 CAP_GLY 7..71 CDD:214997
leucine-rich repeat 122..144 CDD:275380 6/21 (29%)
LRR_RI <144..338 CDD:238064 56/221 (25%)
LRR 1 147..168 8/20 (40%)
leucine-rich repeat 148..173 CDD:275380 10/24 (42%)
LRR 2 173..194 7/22 (32%)
leucine-rich repeat 174..199 CDD:275380 7/26 (27%)
LRR 3 199..220 7/23 (30%)
leucine-rich repeat 200..224 CDD:275380 8/26 (31%)
LRR_8 224..282 CDD:290566 19/80 (24%)
LRR 4 224..245 7/24 (29%)
leucine-rich repeat 225..247 CDD:275380 9/42 (21%)
LRR 5 247..268 4/21 (19%)
leucine-rich repeat 248..271 CDD:275380 4/24 (17%)
LRR 6 271..292 4/20 (20%)
leucine-rich repeat 272..301 CDD:275380 5/28 (18%)
LRR 7 301..322 5/20 (25%)
leucine-rich repeat 302..326 CDD:275380 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2217
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.