DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mlt and tbcela

DIOPT Version :9

Sequence 1:NP_001260853.1 Gene:mlt / 36072 FlyBaseID:FBgn0265512 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_957047.1 Gene:tbcela / 393726 ZFINID:ZDB-GENE-040426-1719 Length:155 Species:Danio rerio


Alignment Length:114 Identity:46/114 - (40%)
Similarity:66/114 - (57%) Gaps:4/114 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PRLSPL---TSVPALLVLNDCDIDSAGDFDSIREKCQRVRELDLAQNKLSDWSEVFSILEHMPRI 113
            |:.||:   .::|::||||.|.|..|||...|...|..|.||||:.|||.||.|:..|:.::|.:
Zfish    41 PQGSPMKDRLNLPSVLVLNGCGISHAGDQGEIAAFCAHVVELDLSHNKLQDWHEISKIVSNVPNL 105

  Fly   114 EFLNLSKNQLASPIGTLPTAPTI-NLKSLVLNGTYLDWACVDTLLKNLP 161
            ||||||.|||:..:.....|... :::..|||.|.:.|..|.|..:.:|
Zfish   106 EFLNLSSNQLSDAVLDPDCAKAFSSIRRFVLNNTQVSWDTVHTFTQEMP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mltNP_001260853.1 LRR <46..>177 CDD:227223 46/114 (40%)
LRR_RI 57..>276 CDD:238064 43/109 (39%)
leucine-rich repeat 87..112 CDD:275380 12/24 (50%)
leucine-rich repeat 113..137 CDD:275380 10/24 (42%)
leucine-rich repeat 138..162 CDD:275380 8/24 (33%)
leucine-rich repeat 207..232 CDD:275380
leucine-rich repeat 233..260 CDD:275380
leucine-rich repeat 261..285 CDD:275380
UBQ 379..456 CDD:294102
tbcelaNP_957047.1 leucine-rich repeat 55..78 CDD:275380 11/22 (50%)
LRR_8 78..141 CDD:290566 27/62 (44%)
leucine-rich repeat 79..104 CDD:275380 12/24 (50%)
LRR_4 81..117 CDD:289563 21/35 (60%)
leucine-rich repeat 105..130 CDD:275380 10/24 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595832
Domainoid 1 1.000 58 1.000 Domainoid score I10788
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 269 1.000 Inparanoid score I2993
OMA 1 1.010 - - QHG49290
OrthoDB 1 1.010 - - D1495296at2759
OrthoFinder 1 1.000 - - FOG0006363
OrthoInspector 1 1.000 - - otm26242
orthoMCL 1 0.900 - - OOG6_107210
Panther 1 1.100 - - LDO PTHR15140
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2217
SonicParanoid 1 1.000 - - X4632
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.