DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNQ and Rpl37

DIOPT Version :10

Sequence 1:NP_788300.3 Gene:KCNQ / 36071 FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_080345.1 Gene:Rpl37 / 67281 MGIID:1914531 Length:97 Species:Mus musculus


Alignment Length:58 Identity:16/58 - (27%)
Similarity:24/58 - (41%) Gaps:11/58 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 GDQAEEQAK----AGGSRRNLT-------IPVVLYGFLHGNFLGSTLSLRNPRVAPAN 536
            |..|:.:.|    |...|||.|       :.:|...|.||...|:|...:...||.::
Mouse    38 GYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRAAVAASS 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNQNP_788300.3 Ion_trans 72..305 CDD:459842
KCNQ_channel <619..719 CDD:460954
Rpl37NP_080345.1 PTZ00073 1..88 CDD:240257 14/49 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.