DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNQ and Shal

DIOPT Version :9

Sequence 1:NP_788300.3 Gene:KCNQ / 36071 FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_001097646.1 Gene:Shal / 40129 FlyBaseID:FBgn0005564 Length:571 Species:Drosophila melanogaster


Alignment Length:441 Identity:107/441 - (24%)
Similarity:179/441 - (40%) Gaps:129/441 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FYDIRGYKGKCRPGRPNSERILQPRMSLLGKPLNYNRGTRRDVRYRRLQSRLYNFLERPRGLHA- 73
            :.|.|..|      |.|:||::..::|        ..|.:...:...::.:::...|.|   |. 
  Fly   134 YEDYRDRK------RENAERLMDDKLS--------ENGDQNLQQLTNMRQKMWRAFENP---HTS 181

  Fly    74 ----IFYHVMVFLMVFTCLALSVFSTI---------------KEYEEDAVYILFRMEILVVIWFT 119
                :||:|..|.:..:.:| :|..|:               :.|:    .:.|.::...|:.||
  Fly   182 TSALVFYYVTGFFIAVSVMA-NVVETVPCGHRPGRAGTLPCGERYK----IVFFCLDTACVMIFT 241

  Fly   120 MEFGARLWSSGCRSRYQGCLGRLKFVKRPFCIIDIVTILASIVVLGMGTSGQVFATSALRGLRFF 184
            .|:..||:::.         .|.|||:....|||:|.|:...:.||:..:..|  :.|...||.|
  Fly   242 AEYLLRLFAAP---------DRCKFVRSVMSIIDVVAIMPYYIGLGITDNDDV--SGAFVTLRVF 295

  Fly   185 QILRMVRMDRRGGTWKLLGSVVYAHRQELITTMYIGFLG-------LIFASFLVYMWEKDVN-DK 241
            ::.|:.:..|.....::||..:.:...||      |||.       :|||:.:.|. ||:|| ..
  Fly   296 RVFRIFKFSRHSQGLRILGYTLKSCASEL------GFLVFSLAMAIIIFATVMFYA-EKNVNGTN 353

  Fly   242 FSNFAQALWWGVITLCTVGYGDMVPITWQGKLIASCCALLGISFFALPAGILGSGFALKVQQQQR 306
            |::...|.|:.::|:.|:|||||||.|..||::...|:|.|:...|||..::.|.|:....|.||
  Fly   354 FTSIPAAFWYTIVTMTTLGYGDMVPETIAGKIVGGVCSLSGVLVIALPVPVIVSNFSRIYHQNQR 418

  Fly   307 -QKHMIRRRQPAATL-----------------IQAVWRCYAADEHSVSV---------------- 337
             .|...:|:...|.:                 .:|.|   ||.|..:.:                
  Fly   419 ADKRKAQRKARLARIRIAKASSGAAFVSKKKAAEARW---AAQESGIELDDNYRDEDIFELQHHH 480

  Fly   338 ------ATWNIHRVAL-------------PSPPASRASSSFKHNTSFVARL 369
                  .|.:...|.|             |||.||.|     |:|:..|.|
  Fly   481 LLRCLEKTTDREFVELEIPFNGQPKRPGSPSPMASPA-----HSTNSAAGL 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921 64/212 (30%)
Ion_trans_2 221..295 CDD:285168 31/81 (38%)
KCNQ_channel <619..719 CDD:281513
ShalNP_001097646.1 BTB_POZ_Shal-like 6..144 CDD:349727 4/15 (27%)
Ion_trans 188..415 CDD:395416 70/249 (28%)
DUF3399 445..540 CDD:403174 18/90 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439069
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11537
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.