DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNQ and KCNS3

DIOPT Version :9

Sequence 1:NP_788300.3 Gene:KCNQ / 36071 FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_001269357.1 Gene:KCNS3 / 3790 HGNCID:6302 Length:491 Species:Homo sapiens


Alignment Length:346 Identity:93/346 - (26%)
Similarity:153/346 - (44%) Gaps:66/346 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VRYRRLQSRLYNFLERPRGLHAIFYHVMVFLMVFTCL--------ALSVFSTIKEYEEDAVY--- 105
            :|:.:|:.:::..:|.|.      |.:...|:..:.|        |:.|.|..:...||...   
Human   162 LRFGQLRKKIWIRMENPA------YCLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDP 220

  Fly   106 ILFRMEILVVIWFTMEFGARLWSSGCRSRYQGCLGRLKFVKRPFCIIDIVTILASIVVLGMGTS- 169
            :|..:||..:.|||.|...||.::.|:.         ||.|.|..|||.|:|:.....|.:.|. 
Human   221 VLEGVEIACIAWFTGELAVRLAAAPCQK---------KFWKNPLNIIDFVSIIPFYATLAVDTKE 276

  Fly   170 ---------GQVFATSALRGLRFFQILRMVRMDRRGGTWKLLGSVVYAHRQELITTMYIGFLGLI 225
                     |:|  ...||.:|.|:||::.|  ...|...|..::.:::.:..:..:::. :|:.
Human   277 EESEDIENMGKV--VQILRLMRIFRILKLAR--HSVGLRSLGATLRHSYHEVGLLLLFLS-VGIS 336

  Fly   226 FASFLVYMWEKDVNDKFSNFAQ---ALWWGVITLCTVGYGDMVPITWQGKLIASCCALLGISFFA 287
            ..|.|:|..|||  |..|:...   ..||..|::.||||||..|:|..||||||.|.:.||...|
Human   337 IFSVLIYSVEKD--DHTSSLTSIPICWWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVA 399

  Fly   288 LPAGILGSGFALKVQQQQRQKHMIRRRQPAATLIQAVWRC-----------YAADEHSVSVATWN 341
            ||..|:.:.|: |..|:|:...:.:..:.|..      :|           ||...|:...:..:
Human   400 LPITIIFNKFS-KYYQKQKDIDVDQCSEDAPE------KCHELPYFNIRDIYAQRMHTFITSLSS 457

  Fly   342 IHRVALPSPPASRASSSFKHN 362
            :..|.  |.|.|..:||.:.|
Human   458 VGIVV--SDPDSTDASSIEDN 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921 70/220 (32%)
Ion_trans_2 221..295 CDD:285168 33/76 (43%)
KCNQ_channel <619..719 CDD:281513
KCNS3NP_001269357.1 BTB_2 17..116 CDD:280393
BTB 44..122 CDD:197585
Ion_trans 219..417 CDD:278921 68/214 (32%)
Ion_trans_2 329..411 CDD:285168 34/85 (40%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 370..375 4/4 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.