DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNQ and KCNS1

DIOPT Version :9

Sequence 1:NP_788300.3 Gene:KCNQ / 36071 FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster
Sequence 2:XP_016883335.1 Gene:KCNS1 / 3787 HGNCID:6300 Length:527 Species:Homo sapiens


Alignment Length:368 Identity:94/368 - (25%)
Similarity:151/368 - (41%) Gaps:89/368 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IYAFYDIRGYKG-------KCRPGRPNSERILQPR---------MSLLGKPLNYNRGTRRDVRY- 54
            ::||.....|.|       .|...|....|:.||.         .|:...|...:...|...|| 
Human   132 VFAFGQEADYWGLGENALAACCRARYLERRLTQPHAWDEDSDTPSSVDPCPDEISDVQRELARYG 196

  Fly    55 ----RRLQSRLYNFLERP-RGLHAIFYHVMVFLMVFTCLALSVFSTIKEYE-------------- 100
                .||:.||:..:|.| ..|.:..:..:...:|...:|.....::.||:              
Human   197 AARCGRLRRRLWLTMENPGYSLPSKLFSCVSISVVLASIAAMCIHSLPEYQAREAAAAVAAVAAG 261

  Fly   101 -------EDAVYILFRMEILVVIWFTMEFGAR-LWSSGCRSRYQGCLGRLKFVKRPFCIIDIVTI 157
                   :|.|  |.|:|...:.||:.|..:| |.:...|:          |...|..:||||::
Human   262 RSPEGVRDDPV--LRRLEYFCIAWFSFEVSSRLLLAPSTRN----------FFCHPLNLIDIVSV 314

  Fly   158 LASIVVL----GMGTSG-----------QVFATSALRGLRFFQILRMVRMDRRGGTWKLLGSVVY 207
            |...:.|    .:|..|           |||     |.:|.|::|::.|  ...|...|..::.:
Human   315 LPFYLTLLAGVALGDQGGKEFGHLGKVVQVF-----RLMRIFRVLKLAR--HSTGLRSLGATLKH 372

  Fly   208 AHRQELITTMYIGFLGLIFASFLVYMWEKDVNDKFSNFAQALWWGVITLCTVGYGDMVPITWQGK 272
            ::|:..|..:|:. :|:...|.:.|..||:.:..|:......|||.:::.||||||:||:|..||
Human   373 SYREVGILLLYLA-VGVSVFSGVAYTAEKEEDVGFNTIPACWWWGTVSMTTVGYGDVVPVTVAGK 436

  Fly   273 LIASCCALLGISFFALPAGILGSGFALKVQQQQRQKHMIRRRQ 315
            |.||.|.|.||...|||..|:.:.|:          |..||::
Human   437 LAASGCILGGILVVALPITIIFNKFS----------HFYRRQK 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921 66/241 (27%)
Ion_trans_2 221..295 CDD:285168 31/73 (42%)
KCNQ_channel <619..719 CDD:281513
KCNS1XP_016883335.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.