DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNQ and KCNG1

DIOPT Version :9

Sequence 1:NP_788300.3 Gene:KCNQ / 36071 FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_002228.2 Gene:KCNG1 / 3755 HGNCID:6248 Length:513 Species:Homo sapiens


Alignment Length:291 Identity:88/291 - (30%)
Similarity:139/291 - (47%) Gaps:40/291 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RYRRLQSRLYNFLERPR-GLHA-IFYHVMVFLMVFTCLALSV--FSTIKEYEEDA-----VYILF 108
            |..|...||.:.:|||. ||.. :|..:.|..:..|.:.|||  ..:::|.||..     .:.:|
Human   205 RLGRCMRRLRDMVERPHSGLPGKVFACLSVLFVTVTAVNLSVSTLPSLREEEEQGHCSQMCHNVF 269

  Fly   109 RMEILVVIWFTMEFGARLWSSGCRSRYQGCLGRLKFVKRPFCIIDIVTILASIVVL--------- 164
            .:|.:.|.||::||..||..:.         .:..|::.|..:||:|.||...:.|         
Human   270 IVESVCVGWFSLEFLLRLIQAP---------SKFAFLRSPLTLIDLVAILPYYITLLVDGAAAGR 325

  Fly   165 ---GMGTSGQVFATSALRGLRFFQILRMVRMDRRGGTWKLLGSVVYAHRQELITTMYIGFLGLIF 226
               |.|.|........||.||..:||.::|:.|.....:.||  :.|.|......:.:.||.:..
Human   326 RKPGAGNSYLDKVGLVLRVLRALRILYVMRLARHSLGLQTLG--LTARRCTREFGLLLLFLCVAI 388

  Fly   227 ASF--LVYMWEKDVND--KFSNFAQALWWGVITLCTVGYGDMVPITWQGKLIASCCALLGISFFA 287
            |.|  |:|:.|.::.|  :|::.....||.|||:.|||||||||.:..|:::|....|.||...|
Human   389 ALFAPLLYVIENEMADSPEFTSIPACYWWAVITMTTVGYGDMVPRSTPGQVVALSSILSGILLMA 453

  Fly   288 LPAGILGSGFA---LKVQQQQRQKHMIRRRQ 315
            .|...:...|:   |:::|:| ::.|.||.|
Human   454 FPVTSIFHTFSRSYLELKQEQ-ERVMFRRAQ 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921 67/228 (29%)
Ion_trans_2 221..295 CDD:285168 30/77 (39%)
KCNQ_channel <619..719 CDD:281513
KCNG1NP_002228.2 BTB_POZ_KCNG1_2 60..173 CDD:349728
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..204
Ion_trans 227..471 CDD:395416 73/254 (29%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 424..429 4/4 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.