DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNQ and KCND1

DIOPT Version :9

Sequence 1:NP_788300.3 Gene:KCNQ / 36071 FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster
Sequence 2:XP_024308146.1 Gene:KCND1 / 3750 HGNCID:6237 Length:675 Species:Homo sapiens


Alignment Length:596 Identity:135/596 - (22%)
Similarity:215/596 - (36%) Gaps:179/596 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LQSRLYNFLERPRGLHA--IFYHVMVFLMVFTCLALSVFSTI------------KEYEEDAVYIL 107
            |:.||:...|.|....|  :||:|..|.:..:.:| :|..||            :...|......
Human   168 LRQRLWRAFENPHTSTAALVFYYVTGFFIAVSVIA-NVVETIPCRGSARRSSREQPCGERFPQAF 231

  Fly   108 FRMEILVVIWFTMEFGARLWSSGCRSRYQGCLGRLKFVKRPFCIIDIVTILASIVVLGMGTSGQV 172
            |.|:...|:.||.|:..||:::..|.|         |::....:||:|.||...:.|.:..:..|
Human   232 FCMDTACVLIFTGEYLLRLFAAPSRCR---------FLRSVMSLIDVVAILPYYIGLLVPKNDDV 287

  Fly   173 FATSALRGLRFFQILRMVRMDRRGGTWKLLGSVVYAHRQELITTMYIGFL-------GLIFASFL 230
              :.|...||.|::.|:.:..|.....::||..:.:...||      |||       .:|||:.:
Human   288 --SGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASEL------GFLLFSLTMAIIIFATVM 344

  Fly   231 VYMWEKDVN-DKFSNFAQALWWGVITLCTVGYGDMVPITWQGKLIASCCALLGISFFALPAGILG 294
            .|. ||..| ..|::...|.|:.::|:.|:|||||||.|..||:..|.|:|.|:...|||..::.
Human   345 FYA-EKGTNKTNFTSIPAAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIV 408

  Fly   295 SGFALKVQQQQRQKHMIRRRQPAATLIQAVWRCYAADEHSVSVATWNIHRVALPSPPASRASSSF 359
            |.|:....|.||...  ||.|....|.                      |:.|.....:.|...:
Human   409 SNFSRIYHQNQRADK--RRAQQKVRLA----------------------RIRLAKSGTTNAFLQY 449

  Fly   360 KHNTSFVARLPTIRRHKSQTIQTPGGGDGGGVSKPPGSSRASTRYTRTIRDINASVENLEVVQNG 424
            |.|..               ::...|.|..|||.......|.......::|..:..|....|:|.
Human   450 KQNGG---------------LEVGRGLDRVGVSHNGEEGAALIALLHLLQDSGSGEEQALCVRNR 499

  Fly   425 KSMNPSFSE--DSVAETTCLK--------------------NIKNSDASQP----ATLANC---- 459
            .:.......  ..:.:|||.:                    :...|.:|||    :.|::|    
Human   500 SAFEQQHHHLLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRR 564

  Fly   460 ------KLSSSAGSLAQFPDRNRDRDQD-----RRGHGEGEGDQAEEQAKAGGSRRNLTIPVVLY 513
                  :|::|..|::    |...::.|     ||.|             |..||.:|....   
Human   565 AKRRAIRLANSTASVS----RGSMQELDMLAGLRRSH-------------APQSRSSLNAKP--- 609

  Fly   514 GFLHG---------NFLGSTLSLRNPRVAPANDRDLEAGRDEDEVHKDTCQRSNTLPLPVKPDSP 569
               |.         :|:.:.:|:..|   |||..|                       ..:|.||
Human   610 ---HDSLDLNCDSRDFVAAIISIPTP---PANTPD-----------------------ESQPSSP 645

  Fly   570 SGSPGSGRTGR 580
            .|...:|.|.|
Human   646 GGGGRAGSTLR 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921 64/212 (30%)
Ion_trans_2 221..295 CDD:285168 31/81 (38%)
KCNQ_channel <619..719 CDD:281513
KCND1XP_024308146.1 Shal-type 3..28 CDD:288455
BTB_2 42..131 CDD:308049
Ion_trans 185..417 CDD:306908 71/250 (28%)
DUF3399 447..578 CDD:314709 23/145 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.