DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNQ and KCNC4

DIOPT Version :9

Sequence 1:NP_788300.3 Gene:KCNQ / 36071 FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster
Sequence 2:XP_024302558.1 Gene:KCNC4 / 3749 HGNCID:6236 Length:661 Species:Homo sapiens


Alignment Length:418 Identity:112/418 - (26%)
Similarity:177/418 - (42%) Gaps:100/418 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RRLQSRLYNFLERP---RGLHAIFYHVMVFLMVFT---CL----ALSVFSTIKEY---------- 99
            |..|.|::...|.|   |....:.:..:.|::|..   ||    |.::...:.|.          
Human   206 RGWQPRMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVTEILRVGNITSVH 270

  Fly   100 ---EEDAVYILFRMEILVVIWFTMEFGARLWSSGCRSRYQGCLGRLKFVKRPFCIIDIVTILASI 161
               |.:...||..:|.:.|:|||:||..|:   .|      |...|.|||....|||.|.||...
Human   271 FRREVETEPILTYIEGVCVLWFTLEFLVRI---VC------CPDTLDFVKNLLNIIDFVAILPFY 326

  Fly   162 VVLGM-GTSGQVF--ATSALRGLRFFQILRMVRMDRRGGTWKLLGSVVYAHRQELITTMYIGFLG 223
            :.:|: |.|.:..  ....||.:||.:|||:.::.|.....::||..:.|...|.:..:....||
Human   327 LEVGLSGLSSKAARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALG 391

  Fly   224 LIFASFLVYMWEK-----------DVNDKFSNFAQALWWGVITLCTVGYGDMVPITWQGKLIASC 277
            ::..:.::|..|:           |..| |.|.....||.|:|:.|:|||||.|.||.|.|:.:.
Human   392 VLIFATMIYYAERIGARPSDPRGNDHTD-FKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGAL 455

  Fly   278 CALLGISFFALPAGIL----GSGFALKVQQQ----QRQKHMIRRRQPAATLIQAVWRCYAADEHS 334
            |||.|:...|:|..::    |..::|.:.:|    :|:||:.|..|     :::...| .::|.|
Human   456 CALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKRKKHVPRPAQ-----LESPMYC-KSEETS 514

  Fly   335 VSVATWNIHRVALPSPPASRASSSFKHNTSFVARLPTIRRHKSQTIQTPGGGD---------GGG 390
            ...:|     .:..||||....              .|.|.::.:.|   .||         |.|
Human   515 PRDST-----CSDTSPPAREEG--------------MIERKRADSKQ---NGDANAVLSDEEGAG 557

  Fly   391 VSKPPGSS------RASTRYTRTIRDIN 412
            :::|..||      ||..|  .|.||.|
Human   558 LTQPLASSPTPEERRALRR--STTRDRN 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921 70/226 (31%)
Ion_trans_2 221..295 CDD:285168 29/88 (33%)
KCNQ_channel <619..719 CDD:281513
KCNC4XP_024302558.1 Potassium_chann 1..29 CDD:314363
BTB_2 38..143 CDD:308049
Ion_trans 225..483 CDD:306908 75/267 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.