DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNQ and KCNA10

DIOPT Version :9

Sequence 1:NP_788300.3 Gene:KCNQ / 36071 FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_005540.1 Gene:KCNA10 / 3744 HGNCID:6219 Length:511 Species:Homo sapiens


Alignment Length:267 Identity:70/267 - (26%)
Similarity:120/267 - (44%) Gaps:41/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LYNFLERPRGLHAIFYHVMVFLMVFTCLALSVFSTIKEYEED-------------AVYIL----- 107
            |:.:.|......|:  .|:..|:|...:.:....|:.|:.||             :..:|     
Human   205 LFEYPESSSAARAV--AVVSVLVVVISITIFCLETLPEFREDRELKVVRDPNLNMSKTVLSQTMF 267

  Fly   108 ----FRMEILVVIWFTMEFGARLWSSGCRSRYQGCLGRLKFVKRPFCIIDIV-------TILASI 161
                |.:|...::|||.|...         |:..|..:..|.:....||||:       |::..:
Human   268 TDPFFMVESTCIVWFTFELVL---------RFVVCPSKTDFFRNIMNIIDIISIIPYFATLITEL 323

  Fly   162 VVLGMGTSGQVFATSALRGLRFFQILRMVRMDRRGGTWKLLGSVVYAHRQELITTMYIGFLGLIF 226
            |.....::.|..:.:.||.:|..::.|:.::.|.....::||..:.|..:||...::..|:|:|.
Human   324 VQETEPSAQQNMSLAILRIIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVIL 388

  Fly   227 ASFLVYMWEKDVNDK-FSNFAQALWWGVITLCTVGYGDMVPITWQGKLIASCCALLGISFFALPA 290
            .|..||..|.|..:. ||:.....||.|:|:.|||||||.|.|..||::.:.||:.|:...|||.
Human   389 FSSAVYFAEVDEPESHFSSIPDGFWWAVVTMTTVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPV 453

  Fly   291 GILGSGF 297
            .::.|.|
Human   454 PVIVSNF 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921 62/228 (27%)
Ion_trans_2 221..295 CDD:285168 31/74 (42%)
KCNQ_channel <619..719 CDD:281513
KCNA10NP_005540.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..50
BTB_2 88..179 CDD:308049
Ion_trans 255..467 CDD:306908 60/215 (28%)
Selectivity filter. /evidence=ECO:0000250 421..426 4/4 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 489..511
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.