DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNQ and Kcna7

DIOPT Version :9

Sequence 1:NP_788300.3 Gene:KCNQ / 36071 FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_001102384.1 Gene:Kcna7 / 365241 RGDID:1309632 Length:489 Species:Rattus norvegicus


Alignment Length:224 Identity:66/224 - (29%)
Similarity:108/224 - (48%) Gaps:20/224 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 FRMEILVVIWFTMEFGARLWSSGCRSRYQGCLGRLKFVKRPFCIIDIVTILASIVVLG------M 166
            |.:|.|.:.||:.|...||         ..|..:..|.|....:||.|.||...|.||      .
  Rat   243 FVVETLCICWFSFELLVRL---------AACPSKAVFFKNVMNLIDFVAILPYFVALGTELARQR 298

  Fly   167 GTSGQVFATSALRGLRFFQILRMVRMDRRGGTWKLLGSVVYAHRQELITTMYIGFLGLIFASFLV 231
            |......:.:.||.:|..::.|:.::.|.....::||..:.|..:||...::..|:|::..|..|
  Rat   299 GVGQPAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRASMRELGLLIFFLFIGVVLFSSAV 363

  Fly   232 YMWEKDVND-KFSNFAQALWWGVITLCTVGYGDMVPITWQGKLIASCCALLGISFFALPAGILGS 295
            |..|.|..| .|::..::.||.|:|:.|||||||.|:|..||::.|.||:.|:...:||..::.|
  Rat   364 YFAEVDRADTHFTSIPESFWWAVVTMTTVGYGDMAPVTVGGKIVGSLCAIAGVLTISLPVPVIVS 428

  Fly   296 GFAL----KVQQQQRQKHMIRRRQPAATL 320
            .|:.    :.:.::...:.....||..||
  Rat   429 NFSYFYHRETEGEEAGMYSHVDTQPCGTL 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921 62/207 (30%)
Ion_trans_2 221..295 CDD:285168 30/74 (41%)
KCNQ_channel <619..719 CDD:281513
Kcna7NP_001102384.1 BTB_2 47..137 CDD:280393
BTB 47..130 CDD:197585
Ion_trans 228..437 CDD:278921 62/202 (31%)
Ion_trans_2 352..431 CDD:285168 31/78 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.