DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNQ and Kcna10

DIOPT Version :9

Sequence 1:NP_788300.3 Gene:KCNQ / 36071 FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_001074609.1 Gene:Kcna10 / 242151 MGIID:3037820 Length:511 Species:Mus musculus


Alignment Length:259 Identity:70/259 - (27%)
Similarity:115/259 - (44%) Gaps:44/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 RGLHAIFYHVMVFLMVFTCLALSVFSTIKEYEEDAVYIL----------------------FRME 111
            ||:..:...|:|..:...||     .|:.|:.||....:                      |.:|
Mouse   216 RGVAVVSVLVVVISITIFCL-----ETLPEFREDRELKVVRDPSINTNKTGLSQTMFTDPFFMVE 275

  Fly   112 ILVVIWFTMEFGARLWSSGCRSRYQGCLGRLKFVKRPFCIIDIV-------TILASIVVLGMGTS 169
            ...::|||.|...         |:..|..:..|.|....||||:       |::..:|.....::
Mouse   276 STCIVWFTFELVL---------RFVVCPSKTDFFKNIMNIIDIISIIPYFATLITELVQETEPSA 331

  Fly   170 GQVFATSALRGLRFFQILRMVRMDRRGGTWKLLGSVVYAHRQELITTMYIGFLGLIFASFLVYMW 234
            .|..:.:.||.:|..::.|:.::.|.....::||..:.|..:||...::..|:|:|..|..||..
Mouse   332 QQNMSLAILRIIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFA 396

  Fly   235 EKDVNDK-FSNFAQALWWGVITLCTVGYGDMVPITWQGKLIASCCALLGISFFALPAGILGSGF 297
            |.|..:. ||:.....||.|:|:.|||||||.|.|..||::.:.||:.|:...|||..::.|.|
Mouse   397 EVDEPESHFSSIPDGFWWAVVTMTTVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNF 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921 62/228 (27%)
Ion_trans_2 221..295 CDD:285168 31/74 (42%)
KCNQ_channel <619..719 CDD:281513
Kcna10NP_001074609.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..44
BTB_2 88..179 CDD:280393
BTB 88..171 CDD:197585
Ion_trans 267..467 CDD:278921 60/203 (30%)
Ion_trans_2 382..458 CDD:285168 31/75 (41%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 421..426 4/4 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 489..511
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.