DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNQ and kvs-3

DIOPT Version :9

Sequence 1:NP_788300.3 Gene:KCNQ / 36071 FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_505407.2 Gene:kvs-3 / 185719 WormBaseID:WBGene00018402 Length:451 Species:Caenorhabditis elegans


Alignment Length:291 Identity:81/291 - (27%)
Similarity:136/291 - (46%) Gaps:51/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RLYNFLERPRGLH-AIFYHVMVFLMVFTCLALSVFSTIKEYEE---DAVYILFRMEILVVIWFTM 120
            :||..:|.||... |..:.|...|.|...|...:.|::.|.::   :..|:|..:|:|.:::||.
 Worm   167 KLYRLMENPRSSSGAKIFSVGSALFVLLSLLGLILSSMPELQDENKEPHYLLHWLELLCMVYFTF 231

  Fly   121 EFGARLWSSGCRSRYQGCLGRLKFVKRPFCIIDIVTILASIVVLGMGTSGQVF-----------A 174
            |:.|||..:..::         :|::.|..:||::|:|..::        :.|           |
 Worm   232 EYLARLLVNPKKA---------EFIRSPLNVIDLLTVLPFMI--------EAFNELQWMKEFRGA 279

  Fly   175 TSALRGLRFFQILRMVRMDRRGGTWKLLGSVVYAHRQELITTMYIGFL--GLIFASFLVYMWEKD 237
            ...:|.:|..::.|:.::.|.....:..|..:.....||  :|...||  |::..|..:|.:|:|
 Worm   280 MLVVRVMRLARVARIFKLARYSTGLRAFGETMKKSAAEL--SMLGMFLVTGIMLFSTAIYFFERD 342

  Fly   238 -VNDKFSNFAQALWWGVITLCTVGYGDMVPITWQGKLIASCCALLGISFFALPAGILGSGFALKV 301
             .|.||.:...|.||.|||:.||||||:||||..||::|:..::.||...|.|..::...||...
 Worm   343 EPNSKFYSIPAACWWCVITMTTVGYGDLVPITAGGKVVAALASVCGIIVLAFPISMIIDKFAEST 407

  Fly   302 ------QQQQRQKHMIRRR--------QPAA 318
                  ...:.|.|||..|        .|||
 Worm   408 GGWSGGDGDEEQGHMIVHRTVHPLNNGAPAA 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921 61/227 (27%)
Ion_trans_2 221..295 CDD:285168 33/76 (43%)
KCNQ_channel <619..719 CDD:281513
kvs-3NP_505407.2 BTB 26..133 CDD:197585
BTB_2 28..127 CDD:280393
Ion_trans 206..407 CDD:278921 62/219 (28%)
Ion_trans_2 324..405 CDD:285168 34/80 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.