DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNQ and exp-2

DIOPT Version :9

Sequence 1:NP_788300.3 Gene:KCNQ / 36071 FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_001367760.1 Gene:exp-2 / 179003 WormBaseID:WBGene00001374 Length:510 Species:Caenorhabditis elegans


Alignment Length:309 Identity:75/309 - (24%)
Similarity:139/309 - (44%) Gaps:60/309 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RLQSRLYNFLERP-RGLHAIFYHVMVFLMVFTCLALSV----FSTIKEYE--------------- 100
            :|:.|::.||||| ..:.|..:.:...|.|    |:||    |.||.:::               
 Worm   208 KLRRRMWTFLERPGSSMQAKAFELSSTLFV----AISVMGLSFGTIPDFQVTHLMPPHNETVVLP 268

  Fly   101 ---------------EDAVYILFRMEILVVIWFTMEFGARLWSSGCRSRYQGCLGRLKFVKRPFC 150
                           |...::.  .|.:.:.:||:|:..|.:::.         .:|:|..:|..
 Worm   269 NGTVTVVQKVEQMRVEHPAFVF--TERICIAFFTVEYCLRFFAAP---------RKLRFALKPLN 322

  Fly   151 IIDIVTILASIVVLGMGTSG--------QVFATSALRGLRFFQILRMVRMDRRGGTWKLLGSVVY 207
            ::|::.|:...:.|.:...|        ..:|...:|.||..:::|::::.|.....:..|..:.
 Worm   323 LVDLLAIVPFYLELLLTLCGVDDRKLRDLRWAFLVVRILRVLRVIRIIKLGRFSSGLQTFGMTLQ 387

  Fly   208 AHRQELITTMYIGFLGLIFASFLVYMWEKD-VNDKFSNFAQALWWGVITLCTVGYGDMVPITWQG 271
            ..:::|.....:...|::|.|.::|..||| ....|::...|.||.::|:.||||||.||.|..|
 Worm   388 RSQKQLQMMTIVLLTGVVFFSTMIYFLEKDEEGTPFTSIPAAYWWCIVTMTTVGYGDAVPATTMG 452

  Fly   272 KLIASCCALLGISFFALPAGILGSGFALKVQQQQRQKHMIRRRQPAATL 320
            |:|||...:.|:...|||..|:...| :||.|.::|....:..|.:..|
 Worm   453 KIIASAAIMCGVLVLALPITIIVDNF-IKVAQDEQQAEQQKNDQQSEQL 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921 56/243 (23%)
Ion_trans_2 221..295 CDD:285168 31/74 (42%)
KCNQ_channel <619..719 CDD:281513
exp-2NP_001367760.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.