DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNQ and LOC1270447

DIOPT Version :10

Sequence 1:NP_788300.3 Gene:KCNQ / 36071 FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster
Sequence 2:XP_309142.3 Gene:LOC1270447 / 1270447 VectorBaseID:AGAMI1_011251 Length:91 Species:Anopheles gambiae


Alignment Length:57 Identity:13/57 - (22%)
Similarity:20/57 - (35%) Gaps:7/57 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   543 GRDEDEVHKDTCQRSNTLPLPVKPDSPS------GSPGSGRTGRFFAAASHFLETGF 593
            ||....:.|.||.|.......::..:.|      .:.|:||. |:..........||
Mosquito    23 GRSSYHIQKHTCSRCGYPAAKIRSYNWSEKAKRRRTTGTGRM-RYLKVVRRRFRNGF 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNQNP_788300.3 Ion_trans 72..305 CDD:459842
KCNQ_channel <619..719 CDD:460954
LOC1270447XP_309142.3 PTZ00073 1..91 CDD:240257 13/57 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.