DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNQ and LOC101887046

DIOPT Version :9

Sequence 1:NP_788300.3 Gene:KCNQ / 36071 FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster
Sequence 2:XP_005159814.1 Gene:LOC101887046 / 101887046 -ID:- Length:258 Species:Danio rerio


Alignment Length:135 Identity:61/135 - (45%)
Similarity:85/135 - (62%) Gaps:12/135 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GRPNSERILQPRMSLLGKPLNYNRGTR-----RDVRYRRLQSRLYNFLERPRGLHAIFYHVMVFL 82
            |.|:.      |..|||.||....|.|     ...|||:||:.|||.|||||| .|..||..:||
Zfish    46 GHPSH------RTGLLGTPLPVPPGPRATPSASSKRYRKLQNCLYNVLERPRG-WAFIYHAFIFL 103

  Fly    83 MVFTCLALSVFSTIKEYEEDAVYILFRMEILVVIWFTMEFGARLWSSGCRSRYQGCLGRLKFVKR 147
            :||:||.|||||||.::.:.|...||.:|.::::.|.:|:..|:|::||..||:|..|||:|.::
Zfish   104 LVFSCLVLSVFSTIPDHHKFANEALFILEFVMIVVFGLEYFVRIWAAGCCCRYRGWQGRLRFARK 168

  Fly   148 PFCII 152
            |||:|
Zfish   169 PFCVI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921 21/53 (40%)
Ion_trans_2 221..295 CDD:285168
KCNQ_channel <619..719 CDD:281513
LOC101887046XP_005159814.1 KCNQ_channel <190..216 CDD:281513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1168835at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.