DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12917 and EXOG

DIOPT Version :9

Sequence 1:NP_610558.2 Gene:CG12917 / 36065 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_005098.2 Gene:EXOG / 9941 HGNCID:3347 Length:368 Species:Homo sapiens


Alignment Length:99 Identity:32/99 - (32%)
Similarity:45/99 - (45%) Gaps:8/99 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 NRGHMVASADFLFTDQ-MGSTFRYLNVVPQFKSINDGNWEKIERWVRSQIPKSSYFRVKSGGIGI 269
            :||||..:.:..|:.: |..||...|:|||....|.|.|.:||.:.|....:.....|.||.   
Human   137 SRGHMAPAGNNKFSSKAMAETFYLSNIVPQDFDNNSGYWNRIEMYCRELTERFEDVWVVSGP--- 198

  Fly   270 LTLPDTRG----FLQSAFLAGSKIPVPEWTYKAV 299
            ||||.|||    .:....:....:.||...||.:
Human   199 LTLPQTRGDGKKIVSYQVIGEDNVAVPSHLYKVI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 32/99 (32%)
EXOGNP_005098.2 NUC 77..286 CDD:214683 32/99 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148111
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12632
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.