DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12917 and XB5812267

DIOPT Version :9

Sequence 1:NP_610558.2 Gene:CG12917 / 36065 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001072816.1 Gene:XB5812267 / 780277 XenbaseID:XB-GENE-5812268 Length:297 Species:Xenopus tropicalis


Alignment Length:208 Identity:39/208 - (18%)
Similarity:68/208 - (32%) Gaps:62/208 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 KDLELYRTCFDCGQGRLVYS-------QSDVYYKTFFPKRPFV-----------EFVADEMFSPQ 172
            |:::.:.:.:|.|:...:||       ...::.:..|...|.:           |...:...:.:
 Frog    62 KNIDYFASLYDRGRHVPLYSAYILNRKHESLHRRNTFDVEPQLINIGLSPSMQSESTTETAITDK 126

  Fly   173 EAAAYMKSNIYF--AFKCIYGDDQSYLQNANYLVINRGHMVASADFLFTDQMGSTFRYLNVVPQF 235
            :.....|:.|.|  |....||       |.:|   :|||:.............:||...|.||..
 Frog   127 KIPGNPKTLIAFSQAVNADYG-------NRSY---HRGHLNPVCHHETKAAQDATFTLTNAVPMV 181

  Fly   236 KSINDGNWEKIERWV-------------------------RSQIPK---SSYFRVKSGG----IG 268
            ...|.|.|...|:.:                         |..||.   |:|..|.:.|    .|
 Frog   182 SGFNQGKWRVHEKRMIEETKDCNITYVVTGIIPGNNRLNNRVNIPSRVWSAYCCVNNNGKPVKSG 246

  Fly   269 ILTLPDTRGFLQS 281
            .:...:|:|.:.|
 Frog   247 AVLAENTKGAVVS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 38/205 (19%)
XB5812267NP_001072816.1 Endonuclease_NS 65..271 CDD:214889 38/205 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.