DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12917 and zgc:153118

DIOPT Version :9

Sequence 1:NP_610558.2 Gene:CG12917 / 36065 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_021326782.1 Gene:zgc:153118 / 767704 ZFINID:ZDB-GENE-060929-792 Length:352 Species:Danio rerio


Alignment Length:214 Identity:45/214 - (21%)
Similarity:80/214 - (37%) Gaps:42/214 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DGDCAGNLYAVGYTIDGKDLELYR-TCFDCGQGRLVYSQSDVYYKTFFPKRPFVEFVADEMF--- 169
            |..| |..:|.|.:....|.:.|: .|.:|  .|.......|::.||:.....:...:..:|   
Zfish    88 DKSC-GKFFAYGKSPTRFDGDHYKQICHEC--LRTTDLDDAVHFATFYDTHNKIPVYSAYVFEGL 149

  Fly   170 -----------SPQEAA---AYMKSNIYF-AFKCI--YGDDQSYLQNANYLVINRGHMVASADFL 217
                       .|||:.   ...:.|:.| .|..|  .|::|:..::......:|||:.......
Zfish   150 MDCTRLNSWYIEPQESLDDDNNAEENMEFETFVDIGELGENQALNKDYYRSGFDRGHLAPVYHAN 214

  Fly   218 FTDQMGSTFRYLNVVPQFKSINDGNWEKIERWVRS--QIPKSSYFRVKSGGIGILT--LPDTRGF 278
            ..:...:||...|..||..|.|...|..:|:.:.:  .|..:.|      .:.|:|  :||....
Zfish   215 SQECADATFTLTNAAPQNHSFNRVEWRLLEKSIANDLSITCAEY------NVYIVTGVVPDYNQT 273

  Fly   279 LQSAFLAGSKIPVPE--WT 295
            :      .:::.||.  ||
Zfish   274 I------NNRVNVPSHFWT 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 39/194 (20%)
zgc:153118XP_021326782.1 Endonuclease_NS 127..341 CDD:214889 34/172 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.