DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12917 and CG3819

DIOPT Version :9

Sequence 1:NP_610558.2 Gene:CG12917 / 36065 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001262027.1 Gene:CG3819 / 40069 FlyBaseID:FBgn0036833 Length:423 Species:Drosophila melanogaster


Alignment Length:287 Identity:74/287 - (25%)
Similarity:124/287 - (43%) Gaps:34/287 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 MRCLSPMQPVTKHIRDG-DCAG--NLYAVGYTIDGKDLEL-YRTCF--DCGQGRLVYSQ---SDV 149
            ::|.|  .||....:.| .|.|  .|..||:.:.|..... |..||  |....|.||.:   .:.
  Fly   128 IKCTS--WPVFVGKKSGSSCNGGTTLIKVGFELSGSRFATQYEVCFNEDEEVTRYVYHRLEPGNN 190

  Fly   150 YYKTFFPKRPFVEFVADEMFSPQE-----AAAYMKSNIYFAFKCIYGDDQSYLQNANYLVINRGH 209
            ||.|...:   :.|.|...|:.:.     ..|..|..|   .|.:..|...:..:|..:.:.|||
  Fly   191 YYATGVDR---ITFGAGGYFAGKNVDKLYTQAVQKETI---DKELDMDSSRFFDSAKNIFLARGH 249

  Fly   210 MVASADFLFTDQMGSTFRYLNVVPQFKSINDGNWEKIERWVRSQIPK-SSYFRVKSGGIGILTLP 273
            |.|.|||:|..:..:||.::|..||:::.|.|||.::|..||:.:.| :.:....:|..|:.|||
  Fly   250 MGAKADFVFAPEQRATFLFINAAPQWQTFNAGNWARVEDGVRAWVAKENKHVECWTGVWGVTTLP 314

  Fly   274 DTRGFLQSAFLA-----GSKIPVPEWTYKAV-RDATGNGLYVFLTYNSTFQMEKPP-----CLAI 327
            :..|..:..:|:     ...||||:..::.| ..:|..|:.:....|....:|:..     |..:
  Fly   315 NKNGEQRQLYLSHDNNGNGLIPVPKLYFRVVIEPSTKKGIVLIGVNNPHLSLEEIKRDYILCTDV 379

  Fly   328 CYPVNCPIHLPNNPNDGYTFCCDPKRF 354
            ...:|.......:...||::.|:...|
  Fly   380 SDRINWISWKKTDITAGYSYACEVPEF 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 62/246 (25%)
CG3819NP_001262027.1 NUC 164..415 CDD:238043 63/249 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450462
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.