DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12917 and EndoG

DIOPT Version :9

Sequence 1:NP_610558.2 Gene:CG12917 / 36065 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster


Alignment Length:170 Identity:44/170 - (25%)
Similarity:68/170 - (40%) Gaps:21/170 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 VYSQSDVYYKTFFPKRPFVEFVADEMFSPQEAAAYMKSNIYFAFKCIYGDDQSY-----LQNANY 202
            |.|.||  |...:.:|   ..|...:|....|.:..|::.....||.:..|:|.     .||.:|
  Fly    87 VRSHSD--YVLSYDRR---NRVPHWVFEHLTAESVAKNDAVDRSKCDFKQDESIHPFFRSQNTDY 146

  Fly   203 --LVINRGHMVASADF-LFTDQMGSTFRYLNVVPQF-KSINDGNWEKIERWVRSQIPKSSYFRVK 263
              ...:||||.|:.:. |.......||...|:.||. :..|...|..:|..||......|...|.
  Fly   147 RRSGYDRGHMAAAGNHRLHQKHCDETFYLSNMAPQVGQGFNRDAWNTLEAHVRRLTKTYSNVYVC 211

  Fly   264 SGGIGILTLP----DTRGFLQSAFLAGSKIPVPEWTYKAV 299
            :|.   |.||    |.:.:::...:..:.:.||...||.:
  Fly   212 TGP---LYLPHKEDDGKSYVKYEVIGANTVAVPTHFYKVI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 44/170 (26%)
EndoGNP_610737.1 NUC1 39..305 CDD:224777 44/170 (26%)
NUC 77..309 CDD:238043 44/170 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.