DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12917 and Tengl1

DIOPT Version :9

Sequence 1:NP_610558.2 Gene:CG12917 / 36065 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_722780.1 Gene:Tengl1 / 318883 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster


Alignment Length:332 Identity:60/332 - (18%)
Similarity:101/332 - (30%) Gaps:112/332 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 VYCSPSVFKETVCQDNGQFSVPLPMRCLSPMQPVTKHIRDGDC--AGNLYAVGYTIDGKDLELYR 132
            :|....:|  .|..||.:|.|.                 ..||  .|.:...|:. ...|:.:..
  Fly    51 LYALLGIF--AVRPDNSEFDVD-----------------TDDCHKLGGIMKYGFP-STNDITINE 95

  Fly   133 TCFDCGQGRLVYSQSDVYYKTFFPKRPFVEFVADEMFSPQEAAAYMKSNIYFAFKCIYGDDQS-- 195
            | ||              :.|.|.:|             ..|..:|...:..:.:.:|||..|  
  Fly    96 T-FD--------------FVTSFDRR-------------NSAILWMCERVDLSNRVVYGDSTSVA 132

  Fly   196 --------------YLQNANYLVINRGHMVASADFL------FTDQMGSTFRYLNVVPQFKSIND 240
                          :|.|.... :|||..:...|.|      .:.:.|:.:.|...:...:.:..
  Fly   133 PAGAFGQSEAARVFFLSNIRPF-LNRGFNLTVWDRLLQYVHEMSQRHGTVYAYTGSIYLPRELKS 196

  Fly   241 GNWEKIERWVRSQIPKSSYFRVKSGGIGILTLPDTRGFLQSAFLAGSKIPVPEWTY--------- 296
            .:|     ::..|..:.:...|.:....||.: |.:       .||..||..| .|         
  Fly   197 NSW-----FLEFQSEERTMVAVPTHFFKILVI-DKK-------FAGDTIPYAE-AYVMPNSPLNN 247

  Fly   297 -----------KAVRDATGNGLYVFLTYN-STFQMEKPPCLAICYPVNCPIHLP-NNPNDGY--- 345
                       :.:.:|||...:..|..| ...|.......::..|:..|:.|| .|..|.:   
  Fly   248 NVELKTLLSDVREIENATGLRFFEGLDRNFVNTQASNSFVPSVNGPLTNPLTLPMTNALDSHSAL 312

  Fly   346 TFCCDPK 352
            |....||
  Fly   313 TSSISPK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 48/271 (18%)
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 35/218 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.