DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12917 and pnu1

DIOPT Version :9

Sequence 1:NP_610558.2 Gene:CG12917 / 36065 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_594598.2 Gene:pnu1 / 2542291 PomBaseID:SPAC17C9.08 Length:322 Species:Schizosaccharomyces pombe


Alignment Length:228 Identity:53/228 - (23%)
Similarity:80/228 - (35%) Gaps:66/228 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 YRTCFDCGQGRLVYSQSDVYYKTFFPK---RPFVEFVADEMFSPQEAAAYMKSNIYFAFKCIYGD 192
            |.:.||.......|:...:..::...:   |.:.|||.|:             ||...|:...||
pombe    81 YMSVFDRRTRNPFYTAETITQESLNQRKGNRRYSEFVPDD-------------NIPEMFQAKLGD 132

  Fly   193 DQSYLQNANYLVINRGHMVASADFLFTDQ-MGSTFRYLNVVPQFKSINDG----NWEKIERWVRS 252
                .:.:.|   :|||.|.:||..|:.: |..||...|:.||   :.||    .|...|.|.|.
pombe   133 ----YRGSGY---DRGHQVPAADCKFSQEAMNETFYLSNMCPQ---VGDGFNRNYWAYFEDWCRR 187

  Fly   253 QIPKSSYFRVKSGGIGILTLP------DTRGFLQSAF-LAGS--KIPVPEWTYKAVRDATGNGLY 308
                   ...|.|.:.|:|.|      :.||..:..: :.|:  .:.||...:|           
pombe   188 -------LTSKYGSVTIMTGPLYLPKKNERGQWEVQYRVIGNPPNVAVPTHFFK----------- 234

  Fly   309 VFLTYNSTFQMEKPPCLAICYPVNCPIHLPNNP 341
            |.:...|......|...|..        |||.|
pombe   235 VIIAEKSGEPTSSPSVAAFV--------LPNKP 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 53/228 (23%)
pnu1NP_594598.2 NUC1 5..309 CDD:224777 53/228 (23%)
NUC 78..289 CDD:214683 53/228 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.