DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12917 and ENDOG

DIOPT Version :9

Sequence 1:NP_610558.2 Gene:CG12917 / 36065 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_011516649.1 Gene:ENDOG / 2021 HGNCID:3346 Length:338 Species:Homo sapiens


Alignment Length:173 Identity:39/173 - (22%)
Similarity:65/173 - (37%) Gaps:42/173 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LPMRCLSPMQPVTKHIRDGDCAGNLYAVGYTIDG----KDLELYRTCFDCGQGRLVYSQSDVYYK 152
            ||:...:.:.||     .|...|......|.:.|    |..|.|..|:|                
Human   132 LPVAAAAELPPV-----PGGPRGPGELAKYGLPGLAQLKSRESYVLCYD---------------- 175

  Fly   153 TFFPKRPFVEFVADEMFSPQEAAAYMKSNIYFAFKCIYGDDQSY-----LQNANY--LVINRGHM 210
               |:.....:|.::: .|:.........     :|.:.:|.|.     ..||:|  ...:|||:
Human   176 ---PRTRGALWVVEQL-RPERLRGDGDRR-----ECDFREDDSVHAYHRATNADYRGSGFDRGHL 231

  Fly   211 VASADFLFTDQ-MGSTFRYLNVVPQFKSINDGNWEKIERWVRS 252
            .|:|:..::.: |..||...||.||...:|...|..:|::.||
Human   232 AAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNNLEKYSRS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 30/132 (23%)
ENDOGXP_011516649.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.