DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12917 and si:dkey-243k1.3

DIOPT Version :9

Sequence 1:NP_610558.2 Gene:CG12917 / 36065 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001373225.1 Gene:si:dkey-243k1.3 / 100537487 ZFINID:ZDB-GENE-131121-191 Length:283 Species:Danio rerio


Alignment Length:183 Identity:41/183 - (22%)
Similarity:70/183 - (38%) Gaps:50/183 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 YRTCFDCGQGRLVYSQSDVYYKTFF--------PKRPFVEFVADEMFSPQEAA--------AYMK 179
            :.|.:|      .|.:..||....|        .||.|||   .::.||..:.        :...
Zfish    64 FATLYD------TYHRIAVYSAYIFEPSSGGGREKRWFVE---PQLVSPAWSTEMEDGYKLSQQN 119

  Fly   180 SNIYFAFKCIYGDDQSYLQNANYLVINRGHMVASADFLFTDQMGSTFRYLNVVPQFKSINDGNWE 244
            .:||...|....:|.:   |:.:   :|||:..:.......: .:||...|||||..::|...|.
Zfish   120 PDIYLGEKQALNEDYT---NSGF---DRGHLNPNGHHAVPSR-NATFTLTNVVPQNPTLNQNAWN 177

  Fly   245 KIERWVRS--------------QIPKSSYFRVKSGGIGILTLPDTRGFLQSAF 283
            |.|..:.|              .||.|:.:.:|: .:..:.:|:   :|..||
Zfish   178 KHESKLTSLFKANCHQAYVLVGAIPSSNNWIIKN-NVKRVNIPE---YLWDAF 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 41/183 (22%)
si:dkey-243k1.3NP_001373225.1 Endonuclease_NS 62..263 CDD:214889 41/183 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12511
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.