DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12917 and exog

DIOPT Version :9

Sequence 1:NP_610558.2 Gene:CG12917 / 36065 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_031760009.1 Gene:exog / 100486077 XenbaseID:XB-GENE-981839 Length:353 Species:Xenopus tropicalis


Alignment Length:151 Identity:39/151 - (25%)
Similarity:59/151 - (39%) Gaps:19/151 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 KCIYGDDQSYLQNANYLVINRGHMVASADFLF-TDQMGSTFRYLNVVPQFKSINDGNWEKIERWV 250
            |.....::.||::.    ..||||..:.|..| |:.|..||...|:|||....|.|.|.::|.:.
 Frog   109 KMFSATNEDYLRSG----WTRGHMAPAGDNKFSTEAMAETFYLSNIVPQNYENNAGFWNRMEMYC 169

  Fly   251 RSQIPKSSYFRVKSGGIGILTL-PDTRGFLQSAFLAGSKIPVPEWTYKAVRDATGNGLYVFLTYN 314
            |....:.....|.||.:.:.|| .|.:..:....:....:.||...||.:. ..|.|        
 Frog   170 RDLTKRFEDVWVVSGPLELPTLHEDGKKRVMYEVIGADDVSVPSHLYKVIL-VRGKG-------- 225

  Fly   315 STFQMEKPPCLAICYPVNCPI 335
                .|:|..:......|.||
 Frog   226 ----SEQPLAVGAFVVPNSPI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 39/151 (26%)
exogXP_031760009.1 NUC 66..273 CDD:214683 39/151 (26%)
Exog_C 292..336 CDD:407864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.