DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12917 and si:ch211-133n4.9

DIOPT Version :9

Sequence 1:NP_610558.2 Gene:CG12917 / 36065 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_009292242.1 Gene:si:ch211-133n4.9 / 100000061 ZFINID:ZDB-GENE-070424-126 Length:299 Species:Danio rerio


Alignment Length:292 Identity:69/292 - (23%)
Similarity:103/292 - (35%) Gaps:107/292 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LLVYCSPSVFKETVCQDNGQFSVPLPMRC----LSPMQPVTKHIRDGDCA------------GNL 116
            |||:..|.:..|.|    ..||     :|    |:...||...:.:|..:            .||
Zfish    11 LLVFSFPFITPEVV----DSFS-----KCSQFFLNGEPPVISGLLEGSVSLNDNHKIICQKYQNL 66

  Fly   117 Y--AVGYTIDGKDLELYRTCFDCGQGRLVYSQSDVYYKTFFPKRPFVEFVAD---------EMFS 170
            |  |..|:|...:...:|          :...|...|...:..||.:.::.:         ||.:
Zfish    67 YTFATFYSIKFSERLPHR----------IPVFSAYKYTGSYKGRPRLSWMIEPQLESSDNSEMRA 121

  Fly   171 P----QEAAAYMKSNIYFAFKCIYGDDQSYLQNANYLVINRGHMVA---SADFLFTDQMGSTFRY 228
            |    .||..|...:||                    .|:|||:..   :||.:..:   |||..
Zfish   122 PCVNQAEAGDYYTKDIY--------------------NISRGHLFPNGHAADNITAE---STFTL 163

  Fly   229 LNVVPQFKSINDGNWEKIERWVRSQI---------PKSSYFRVKSGGIGILTLPDTRGFLQSAFL 284
            .|:|||..|.|:|:|.::|:.|||.|         |:.:...|.:|.:     |....||:... 
Zfish   164 TNIVPQVTSFNNGSWVRMEQKVRSIIESDCRDRNNPEKTLAYVLTGAV-----PSKSNFLRKRV- 222

  Fly   285 AGSKIPVPEWTYKAVRDATGNGLYVFLTYNST 316
               .||...||             .|..||||
Zfish   223 ---NIPTHMWT-------------AFCCYNST 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 50/213 (23%)
si:ch211-133n4.9XP_009292242.1 Endonuclease_NS 71..279 CDD:214889 52/223 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12511
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.