DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gem and GRHL1

DIOPT Version :9

Sequence 1:NP_610556.1 Gene:gem / 36064 FlyBaseID:FBgn0050011 Length:932 Species:Drosophila melanogaster
Sequence 2:XP_006711945.1 Gene:GRHL1 / 29841 HGNCID:17923 Length:630 Species:Homo sapiens


Alignment Length:297 Identity:80/297 - (26%)
Similarity:127/297 - (42%) Gaps:76/297 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 PQQLSVLDPAKIEIGSANGATHAEDH--------KFQYILAAATSIATKNNEETLTYLNQGQSYE 427
            |..||:..|          ..::||:        .|:|.|.|:.|:..|..:.|:||||:||.|.
Human   227 PSDLSLRMP----------GMNSEDYVFDSVSGNNFEYTLEASKSLRQKPGDSTMTYLNKGQFYP 281

  Fly   428 IKLKKIGDLSLYRDKI--LKSVIKICFHERRLQFMEREQMQQW-----QQSRPGERIIEV-DVPL 484
            |.||::.........|  ::|||.:.|.|.:   ...:|::.|     :|....:|.|:: |...
Human   282 ITLKEVSSSEGIHHPISKVRSVIMVVFAEDK---SREDQLRHWKYWHSRQHTAKQRCIDIADYKE 343

  Fly   485 SYGLCHVSQPLSSGSLNTVEIFWDPLKEVGVYIKVNCISTEFTPKKHGGEKGVPFRLQIETYIEN 549
            |:   :....:...:.|.:...||...|..|:|.|||:||:|:.:|  |.||:|..:|::||..|
Human   344 SF---NTISNIEEIAYNAISFTWDINDEAKVFISVNCLSTDFSSQK--GVKGLPLNIQVDTYSYN 403

  Fly   550 TNSATASGSGGSNNSAIASGSGSSGSAAPASPERTPSAGSNGKQAVHAAACQIKVFKLKGADRKH 614
            ..|                                       .:.||.|.||||||..|||:||.
Human   404 NRS---------------------------------------NKPVHRAYCQIKVFCDKGAERKI 429

  Fly   615 KQDREKIQKRPQSEQEKFQPSYECTIMNDISLDLVMS 651
            :.:..|..||.....:   ||.:....:|:.:.|:.|
Human   430 RDEERKQSKRKGKCPD---PSSQVNAFSDVKVPLLPS 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gemNP_610556.1 CP2 393..624 CDD:282385 69/246 (28%)
SAM_CP2-like 739..805 CDD:188936
GRHL1XP_006711945.1 CP2 235..442 CDD:282385 72/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144553
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.