DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmpd and Fbxo28

DIOPT Version :9

Sequence 1:NP_001246235.1 Gene:dmpd / 36061 FlyBaseID:FBgn0033486 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_780336.1 Gene:Fbxo28 / 67948 MGIID:1261890 Length:368 Species:Mus musculus


Alignment Length:414 Identity:122/414 - (29%)
Similarity:188/414 - (45%) Gaps:77/414 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SASEGVSPFGGAGSGSASGTGMASGSAVSSGSGTGVQEPPESTANRSSVLRRTTSYQGNQAHSSY 78
            ::.|.::..||.|.|. .|:..|:|||.........|.||                         
Mouse     4 ASEERMAEEGGGGHGD-GGSCSAAGSAQRQPPAPPSQAPP------------------------- 42

  Fly    79 RVVSAGSLAESASAVTRLHSYTMQMQRQRPPTATTTTTTSAPSLYDLPNELIEKILSYVDYKKVS 143
                .||.|.:|.|:...|.          |...|        |..||...||.|||::.|.::|
Mouse    43 ----PGSQAPAAPALAPDHL----------PQNNT--------LVALPIVAIENILSFMSYDEIS 85

  Fly   144 NLRLVSHRMNDICMAMLNTAFTKQIKTTLSRF-----QAIKASMPRRESHRRNHPLACECDIIET 203
            .||||..||:.:|..|||..|.|     :.||     :.:||.:|||||.||||.||...||:..
Mouse    86 QLRLVCKRMDLVCQRMLNQGFLK-----VERFHNLCQKQVKAQLPRRESERRNHSLARHADILAA 145

  Fly   204 CYMRLSLLQMSMGKHIERGHCCFFPGAILDEVQAILNYISITPRLQRPYRVTDELFDLSTMAMEY 268
            ...|||||.|:..|:::...|||.||.::||:..:|.|::.|...||.:.|..||.|:|:|||||
Mouse   146 VETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYRVLRYVNSTRAPQRAHEVLQELRDISSMAMEY 210

  Fly   269 FKDRI----EATLPGLAYFNKDFYTLPTTTKRPTLAISSDLEDSASNSPPQNHMVLRKGIRKIKQ 329
            |.::|    :..|||.....:...:.|  ...|:.|:::....|..|...|....|::.:|....
Mouse   211 FDEKIVPILKRKLPGSDVSGRLMGSPP--VPGPSAALTTMQLFSKQNPSRQEVTKLQQQVRTNGA 273

  Fly   330 GMKMYNNQLSVLRTELRTCKRKAAEQSKQLAEQSNLISEQQKQTLEYANRLDE------------ 382
            |:.:...::|.|||:::..:::..:|.::|.||:.:|.||..:..|...:|.|            
Mouse   274 GVTVLRREISELRTKVQEQQKQLQDQDQKLLEQTQIIGEQNARLAELERKLREVMESAVGTSSGS 338

  Fly   383 -NDKKNEEMSRKFSTLLQELNKCK 405
             ..:::....||.:..:..|.|.|
Mouse   339 GQSEESPRKRRKATEAIDSLRKSK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmpdNP_001246235.1 F-box 122..>156 CDD:279040 16/33 (48%)
Fbxo28NP_780336.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 18/81 (22%)
F-box 67..108 CDD:306992 20/40 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..368 5/35 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843055
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28KQY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13252
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.