DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmpd and Fbxo28

DIOPT Version :9

Sequence 1:NP_001246235.1 Gene:dmpd / 36061 FlyBaseID:FBgn0033486 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_001100673.1 Gene:Fbxo28 / 305105 RGDID:1304584 Length:368 Species:Rattus norvegicus


Alignment Length:395 Identity:118/395 - (29%)
Similarity:172/395 - (43%) Gaps:103/395 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 QGNQAHSSYRVVSAGSLAESASAVTRLHSYTMQMQRQRPPTATTTTTTSAP-------------- 120
            :|...|.     ..||.:.::||         |.|...||:......:.||              
  Rat    12 EGGGGHG-----DGGSCSAASSA---------QRQPPTPPSQALQPGSQAPAAPALAPDHLPQNN 62

  Fly   121 SLYDLPNELIEKILSYVDYKKVSNLRLVSHRMNDICMAMLNTAFTKQIKTTLSRF-----QAIKA 180
            :|..||...||.|||::.|.::|.||||..||:.:|..|||..|.|     :.|:     :.:||
  Rat    63 TLVALPIVAIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQGFLK-----VERYHNLCQKQVKA 122

  Fly   181 SMPRRESHRRNHPLACECDIIETCYMRLSLLQMSMGKHIERGHCCFFPGAILDEVQAILNYISIT 245
            .:|||||.||||.||...||:.....|||||.|:..|:::...|||.||.::||:..:|.|::.|
  Rat   123 QLPRRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYRVLRYVNST 187

  Fly   246 PRLQRPYRVTDELFDLSTMAMEYFKDRI----EATLPGLAYFNKDFYTLPTTTKRPTLAISSDLE 306
            ...||.:.|..||.|:|:||||||.::|    :..|||                       ||:.
  Rat   188 RAPQRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPG-----------------------SDVS 229

  Fly   307 DSASNSPP----------------QNHMVLRKGIRKIKQGMKMYNNQLSVLRTELRTCKRKAAEQ 355
            .....|||                ||..  |:.:.|::|.:|.....::|||.|:...:.|..||
  Rat   230 GRLMGSPPVPGPSAALTTMQLFSKQNPS--RQEVTKLQQQVKTNGAGVTVLRREISELRTKVQEQ 292

  Fly   356 SKQ-------LAEQSNLISEQQKQTLEYANRLDE-------------NDKKNEEMSRKFSTLLQE 400
            .||       |.||:.:|.||..:..|...:|.|             ..:::....||.:..:..
  Rat   293 QKQLQDQDQKLLEQTQIIGEQNARLAELERKLREVMESAVGTSSGSGQSEESPRKRRKATEAIDS 357

  Fly   401 LNKCK 405
            |.|.|
  Rat   358 LRKSK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmpdNP_001246235.1 F-box 122..>156 CDD:279040 16/33 (48%)
Fbxo28NP_001100673.1 F-box 67..108 CDD:279040 20/40 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346559
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28KQY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346120at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13252
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.