DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmpd and FBXO28

DIOPT Version :9

Sequence 1:NP_001246235.1 Gene:dmpd / 36061 FlyBaseID:FBgn0033486 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_055991.1 Gene:FBXO28 / 23219 HGNCID:29046 Length:368 Species:Homo sapiens


Alignment Length:437 Identity:133/437 - (30%)
Similarity:189/437 - (43%) Gaps:123/437 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SASEGVSPFGGAGSGSASGTGMASGSAVSSGSGTGVQEPPESTANRSSVLRRTTSYQGNQAHSSY 78
            :|.|.::..||.|.|.       .||:::||| |..|.||.:..:         ...|:||    
Human     4 AAEERMAEEGGGGQGD-------GGSSLASGS-TQRQPPPPAPQH---------PQPGSQA---- 47

  Fly    79 RVVSAGSLAESASAVTRLHSYTMQMQRQRPPTATTTTTTSAPSLYDLPNELIEKILSYVDYKKVS 143
              :.|.:||..                |.|...|         |..||...||.|||::.|.::|
Human    48 --LPAPALAPD----------------QLPQNNT---------LVALPIVAIENILSFMSYDEIS 85

  Fly   144 NLRLVSHRMNDICMAMLNTAFTKQIKTTLSRF-----QAIKASMPRRESHRRNHPLACECDIIET 203
            .||||..||:.:|..|||..|.|     :.|:     :.:||.:|||||.||||.||...||:..
Human    86 QLRLVCKRMDLVCQRMLNQGFLK-----VERYHNLCQKQVKAQLPRRESERRNHSLARHADILAA 145

  Fly   204 CYMRLSLLQMSMGKHIERGHCCFFPGAILDEVQAILNYISITPRLQRPYRVTDELFDLSTMAMEY 268
            ...|||||.|:..|:::...|||.||.::||:..:|.|::.|...||.:.|..||.|:|:|||||
Human   146 VETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYRVLRYVNSTRAPQRAHEVLQELRDISSMAMEY 210

  Fly   269 FKDRI----EATLPGLAYFNKDFYTLPTTTKRPTLAISSDLEDSASNSPP--------------- 314
            |.::|    :..|||                       ||:......|||               
Human   211 FDEKIVPILKRKLPG-----------------------SDVSGRLMGSPPVPGPSAALTTMQLFS 252

  Fly   315 -QNHMVLRKGIRKIKQGMKMYNNQLSVLRTELRTCKRKAAEQSKQ-------LAEQSNLISEQQK 371
             ||..  |:.:.|::|.:|.....::|||.|:...:.|..||.||       |.||:.:|.||..
Human   253 KQNPS--RQEVTKLQQQVKTNGAGVTVLRREISELRTKVQEQQKQLQDQDQKLLEQTQIIGEQNA 315

  Fly   372 QTLEYANRLDE----------NDKKNEEMSR---KFSTLLQELNKCK 405
            :..|...:|.|          ...:|||..|   |.:..:..|.|.|
Human   316 RLAELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmpdNP_001246235.1 F-box 122..>156 CDD:279040 16/33 (48%)
FBXO28NP_055991.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 21/74 (28%)
F-box 67..108 CDD:366220 20/40 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..368 8/35 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152969
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28KQY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346120at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13252
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.