DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmpd and fbxo28

DIOPT Version :9

Sequence 1:NP_001246235.1 Gene:dmpd / 36061 FlyBaseID:FBgn0033486 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_001096500.1 Gene:fbxo28 / 100125127 XenbaseID:XB-GENE-993737 Length:345 Species:Xenopus tropicalis


Alignment Length:292 Identity:101/292 - (34%)
Similarity:157/292 - (53%) Gaps:23/292 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 QRQRPPTATTTTTTSAPSLYDLPNELIEKILSYVDYKKVSNLRLVSHRMNDICMAMLNTAFTKQI 168
            ||.|..:.::.....:.:|..||...||.|.::::|.::|.||||..||:.:|..|||..|.:  
 Frog    23 QRPRSVSPSSDQLHQSNTLLGLPIVAIENIFNFMNYDEISQLRLVCKRMDAVCQRMLNQGFLR-- 85

  Fly   169 KTTLSRF-----QAIKASMPRRESHRRNHPLACECDIIETCYMRLSLLQMSMGKHIERGHCCFFP 228
               :.|:     :.:||.:|||||.||||.||...||:.....|||||.|:..|:::...|||.|
 Frog    86 ---VERYHNLCQKQVKAQLPRRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIP 147

  Fly   229 GAILDEVQAILNYISITPRLQRPYRVTDELFDLSTMAMEYFKDRI----EATLPGLAYFNKDFYT 289
            |.::||:..:|.|::.|...||.:.|..||.|:|:||||||.::|    :..|||.....:...:
 Frog   148 GKVIDEIYRVLRYVNSTRAPQRAHEVLQELRDISSMAMEYFDEKIVPILKKKLPGSEVSGRLIGS 212

  Fly   290 LPTTTKRPTLAISSDLEDSASNSPPQNHMVLRKGIRKIKQGMKMYNNQLSVLRTELRTCKRKAAE 354
            .|  ...|:.|:|: ::..:..||.      |:.:.|::|.:|.....::|||.||...:.|..|
 Frog   213 PP--VPGPSTALST-MQLFSKQSPS------RQEVTKLQQQVKANGAGMTVLRRELSELRTKVQE 268

  Fly   355 QSKQLAEQSNLISEQQKQTLEYANRLDENDKK 386
            |.|||.:|...:.||.:...|...||.|.:.|
 Frog   269 QQKQLQDQDQKLLEQTQIIGEQNVRLTELEHK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmpdNP_001246235.1 F-box 122..>156 CDD:279040 14/33 (42%)
fbxo28NP_001096500.1 F-box 40..>71 CDD:366220 12/30 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346120at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.