DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfk and PFK2

DIOPT Version :9

Sequence 1:NP_001246234.1 Gene:Pfk / 36060 FlyBaseID:FBgn0003071 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_199592.1 Gene:PFK2 / 834832 AraportID:AT5G47810 Length:444 Species:Arabidopsis thaliana


Alignment Length:512 Identity:115/512 - (22%)
Similarity:193/512 - (37%) Gaps:130/512 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 KLRSDSGDQKNDSPGEKNIQKDKSAQRCGKPINNLHNGF--------LNAVNYS----EKNAVKK 141
            ||.|.||.:...:|.|.|            |..:..|||        |..|.|.    .::.|..
plant     9 KLPSLSGLRHRRNPLEDN------------PYFHPSNGFYITPSDVILAQVAYDHSAHSQSRVAY 61

  Fly   142 KKSAPKRKCGKSVDELRKCLRTMQDVIDFVHPVKPFKDKGLAVFTSGGDSQGMNAAVRACV--RM 204
            .::.|:|                    :.::.....|   .|:.|.||...|||..:|..|  ..
plant    62 HRAGPRR--------------------EIMYEPSAVK---AAIVTCGGLCPGMNTVIRELVVGLW 103

  Fly   205 AIYLGCKVYFIREGYQGMVDGGDCIQEANWASVSSI------IH----RGGTIIGSARCQDFRER 259
            .:|...::|.|..||:|            :.|:.::      :|    :|||::.::| ..|..:
plant   104 ELYGVREIYGIPAGYRG------------FYSMKAVKLDPKAVHDWHKKGGTVLATSR-GGFHLQ 155

  Fly   260 QGRLKAANNLIQRGITNLVVIGGDGSLTGA-NLFRQEWSSLLDELVKNKTITTEQQEKFNVLHIV 323
                |..:.:...|...:.:|||||::.|| .:|              |.|:..:.|    :.|.
plant   156 ----KIVDAIHLNGYNQVYIIGGDGTMRGAVEIF--------------KEISLRKLE----VGIT 198

  Fly   324 GLVGSIDNDFCGTDMTIGTDTALHRIIEAIDAISSTAYSHQRTF-IMEVMGRHCGYLSVVAGIIS 387
            .:..::|||....|.:.|..||:....|||.|....|.|..... ::::|||..|::::.|.:.|
plant   199 VIPKTVDNDVGIIDRSFGFQTAVEMAQEAISAAHVEAESAVNGIGLVKLMGRSTGHIALHATLSS 263

  Fly   388 -EADYVFLPESPPQADWPDRLVLKLEQE-RSAGQRLNIVIVAEGA--------------MDREGH 436
             :.|...:||.....:....|...||:. :..|..  :::|||||              .|..|:
plant   264 RDVDCCLIPEMDFYLEGKGGLFEFLEKRLKERGHA--VLVVAEGAGQEMIPRNESQKQERDESGN 326

  Fly   437 PITAE------DVKKVIDERLKHDARITVL----GHVQRGGNPSAFDRILACRMGAEATLALMEA 491
            .:..:      .|.|...||...|...||.    .::.|....:|.|.:....:...|...:|..
plant   327 AVFLDVGVWFKSVLKAWWEREHPDELFTVKYIDPTYMIRAVPANATDNLYCTLLAHSAIHGVMAG 391

  Fly   492 TKDSVPVVISLDGNQAVRVPLMECVERTQAVAKAMAEKRWADAVKLRGR-SFERNLE 547
            ....||..|  :||.|. :||.|..:....|  ...:.:||....:..: .||.|::
plant   392 YTGFVPGPI--NGNYAY-IPLEEVAQTKNQV--NTRDHKWAWVRSVTNQPDFETNVK 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PfkNP_001246234.1 PFK 178..914 CDD:294137 97/411 (24%)
6PF1K_euk 180..929 CDD:274152 96/409 (23%)
PFK2NP_199592.1 PFK 13..438 CDD:294137 109/501 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2941
eggNOG 1 0.900 - - E1_COG0205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000489
OrthoInspector 1 1.000 - - otm2441
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.